7UWF: Human Rix1 sub-complex scaffold

Human Rix1 sub-complex scaffold. Determined by electron microscopy at 2.7 Å resolution. Released 2 Nov 2022.

Method: Electron microscopy
Resolution: 2.7 Å
Organism: Homo sapiens
Chains: 4
Atoms: 13,174
Mol. weight: 236.81 kDa
Released: 2 Nov 2022

Explore 7UWF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7UWF contains 64 α-helices and 64 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 3 helices, 29 β-strands

Element	Residues	Length	Sheet
β-strand	6-12	7	1
β-strand	20-24	5	1
β-strand	30-34	5	1
β-strand	39-47	9	2
β-strand	51-56	6	2
β-strand	61-66	6	2
β-strand	77-78	2	2
β-strand	83-88	6	3
β-strand	94-99	6	3
β-strand	102-107	6	3
β-strand	113-117	5	3
β-strand	124-129	6	4
β-strand	135-140	6	4
β-strand	145-149	5	4
α-helix	150-154	5
β-strand	166-168	3	4
β-strand	175-180	6	5
β-strand	188-193	6	5
β-strand	197-202	6	5
β-strand	208-213	6	5
β-strand	218-223	6	6
β-strand	229-234	6	6
β-strand	239-243	5	6
β-strand	264-265	2	6
β-strand	272-277	6	7
β-strand	283-288	6	7
β-strand	292-297	6	7
β-strand	302-308	7	7
β-strand	313-320	8	1
α-helix	323-326	4
β-strand	397-398	2	8
α-helix	412-426	15

Chains C and D: 29 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	32-41	10
α-helix	42-44	3
α-helix	66-76	11
α-helix	86-100	15
α-helix	105-118	14
α-helix	121-139	19
α-helix	145-162	18
α-helix	166-185	20
α-helix	189-191	3
α-helix	192-205	14
α-helix	208-213	6
α-helix	214-225	12
α-helix	230-240	11
α-helix	243-245	3
α-helix	250-278	29
α-helix	306-326	21
β-strand	334-335	2	8
α-helix	338-349	12
α-helix	362-387	26
α-helix	388-394	7
α-helix	395-408	14
α-helix	425-442	18
α-helix	443-445	3
α-helix	452-466	15
α-helix	519-536	18
α-helix	542-560	19
α-helix	569-571	3
α-helix	573-588	16
β-strand	591	1	9
β-strand	594	1	9
α-helix	598-608	11
α-helix	614-631	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
WD repeat-containing protein 18	A, B	protein	447	Homo sapiens	Q9BV38 (AlphaFold model)
Modulator of non-genomic activity of estrogen receptor	C, D	protein	652	Homo sapiens	Q8IZL8 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7UWF_1 WD repeat-containing protein 18 (chains A, B)
MAAPMEVAVCTDSAAPMWSCIVWELHSGANLLTYRGGQAGPRGLALLNGEYLLAAQLGKN
YISAWELQRKDQLQQKIMCPGPVTCLTASPNGLYVLAGVAESIHLWEVSTGNLLVILSRH
YQDVSCLQFTGDSSHFISGGKDCLVLVWSLCSVLQADPSRIPAPRHVWSHHALPITDLHC
GFGGPLARVATSSLDQTVKLWEVSSGELLLSVLFDVSIMAVTMDLAEHHMFCGGSEGSIF
QVDLFTWPGQRERSFHPEQDAGKVFKGHRNQVTCLSVSTDGSVLLSGSHDETVRLWDVQS
KQCIRTVALKGPVTNAAILLAPVSMLSSDFRPSLPLPHFNKHLLGAEHGDEPRHGGLTLR
LGLHQQGSEPSYLDRTEQLQAVLCSTMEKSVLGGQDQLRVRVTELEDEVRNLRKINRDLF
DFSTRFITRPAKLESRGPYPYDVPDYA

Sequence of entity 2 (C, D), FASTA

>7UWF_2 Modulator of non-genomic activity of estrogen receptor (chains C, D)
DYKDDDDKGTMAAAVLSGPSAGSAAGVPGGTGGLSAVSSGPRLRLLLLESVSGLLQPRTG
SAVAPVHPPNRSAPHLPGLMCLLRLHGSVGGAQNLSALGALVSLSNARLSSIKTRFEGLC
LLSLLVGESPTELFQQHCVSWLRSIQQVLQTQDPPATMELAVAVLRDLLRYAAQLPALFR
DISMNHLPGLLTSLLGLRPECEQSALEGMKACMTYFPRACGSLKGKLASFFLSRVDALSP
QLQQLACECYSRLPSLGAGFSQGLKHTESWEQELHSLLASLHTLLGALYEGAETAPVQNE
GPGVEMLLSSEDGDAHVLLQLRQRFSGLARCLGLMLSSEFGAPVSVPVQEILDFICRTLS
VSSKNISLHGDGPLRLLLLPSIHLEALDLLSALILACGSRLLRFGILIGRLLPQVLNSWS
IGRDSLSPGQERPYSTVRTKVYAILELWVQVCGASAGMLQGGASGEALLTHLLSDISPPA
DALKLRSPRGSPDGSLQTGKPSAPKKLKLDVGEAMAPPSHRKGDSNANSDVCAAALRGLS
RTILMCGPLIKEETHRRLHDLVLPLVMGVQQGEVLGSSPYTSSRCRRELYCLLLALLLAP
SPRCPPPLACALQAFSLGQREDSLEVSSFCSEALVTCAALTHPRVPPLQPMG

Primary citation

Cryo-EM reveals the architecture of the PELP1-WDR18 molecular scaffold. Gordon, J., Chapus, F.L., Viverette, E.G. et al. Nat Commun (2022) 13:6783-6783. DOI 10.1038/s41467-022-34610-0 · PubMed

Other PDB entries of the same protein (UniProt Q9BV38 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8FL3 2.53 Å, Human nuclear pre-60S ribosomal subunit (State I2)
9DUO 2.66 Å, Human PELP1-WDR18 complex
8FL2 2.67 Å, Human nuclear pre-60S ribosomal subunit (State I1)
8FL4 2.89 Å, Human nuclear pre-60S ribosomal subunit (State I3)
9DUM 3.56 Å, Human PELP1-WDR18-TEX10 complex

Browse structure collections

About this viewer

MolViewer shows 7UWF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.