7UX3: ADP-ribosylation factor 1

Asymmetric unit of AP-1, Arf1, Nef lattice on MHC-I lipopeptide incorporated narrow membrane tubes. Determined by electron microscopy at 9.6 Å resolution. Released 10 May 2023.

Method: Electron microscopy
Resolution: 9.6 Å
Organisms: Homo sapiens, Human immunodeficiency virus 1, Mus musculus
Chains: 9
Atoms: 9,014
Mol. weight: 335.42 kDa
Ligands: MG, GTP
Released: 10 May 2023

Explore 7UX3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7UX3 contains 121 α-helices and 73 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 39 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	15-22	8
α-helix	27-42	16
α-helix	48-50	3
α-helix	51-55	5
α-helix	63-75	13
α-helix	83-86	4
α-helix	88-94	7
α-helix	100-112	13
α-helix	123-130	8
α-helix	135-151	17
α-helix	153-159	7
α-helix	162-169	8
α-helix	174-190	17
α-helix	201-211	11
α-helix	216-224	9
α-helix	225-227	3
α-helix	234-244	11
α-helix	245-249	5
β-strand	250	1	9
α-helix	253-266	14
α-helix	276-291	16
α-helix	296-310	15
α-helix	322-324	3
α-helix	326-327	2
α-helix	332-344	13
α-helix	351-361	11
α-helix	367-383	17
α-helix	385-387	3
α-helix	388-399	12
α-helix	404-420	17
α-helix	429-433	5
α-helix	442-454	13
α-helix	462-469	8
α-helix	478-494	17
α-helix	500-511	12
α-helix	517-532	16
α-helix	536-540	5
α-helix	555-556	2
α-helix	557-565	9
β-strand	569	1	10
α-helix	570-573	4

Chain C: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	5-11	7
β-strand	19-22	4	1
β-strand	23-24	2	2
α-helix	30-38	9
β-strand	51-58	8	1
β-strand	61-68	8	1
α-helix	75-82	8
β-strand	90-93	4	2
α-helix	97-111	15
β-strand	123-126	4	2
α-helix	138-143	6
α-helix	145-147	3
β-strand	155-157	3	2
α-helix	166-177	12

Chain G: 38 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	7-15	9
α-helix	20-39	20
α-helix	46-58	13
α-helix	64-66	3
α-helix	68-74	7
α-helix	79-92	14
α-helix	95-97	3
α-helix	103-111	9
α-helix	118-129	12
α-helix	134-146	13
α-helix	151-167	17
α-helix	169-174	6
α-helix	188-204	17
α-helix	209-212	4
α-helix	216-228	13
β-strand	236-237	2	11
β-strand	240-241	2	11
α-helix	243-255	13
α-helix	261-266	6
α-helix	268-276	9
α-helix	283-297	15
α-helix	303-317	15
α-helix	322-334	13
α-helix	340-343	4
α-helix	344-346	3
α-helix	347-354	8
α-helix	359-371	13
α-helix	378-390	13
α-helix	397-411	15
α-helix	415-429	15
α-helix	437-447	11
α-helix	453-465	13
α-helix	470-487	18
α-helix	504-514	11
α-helix	522-536	15
α-helix	544-550	7
α-helix	551-553	3
α-helix	557-572	16
α-helix	578-580	3
α-helix	582-585	4

Chain H: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	5-11	7
β-strand	19-22	4	3
β-strand	23-24	2	4
α-helix	30-38	9
β-strand	51-58	8	3
β-strand	61-68	8	3
α-helix	75-82	8
β-strand	90-92	3	4
α-helix	97-110	14
β-strand	123-125	3	4
α-helix	138-143	6
α-helix	145-147	3
β-strand	155-157	3	4
α-helix	166-177	12

Chain M: 13 helices, 35 β-strands

Element	Residues	Length	Sheet
β-strand	5-8	4	12
β-strand	17-20	4	12
α-helix	27-32	6
α-helix	33-41	9
β-strand	49	1	12
β-strand	52	1	13
β-strand	55	1	13
β-strand	56-61	6	12
β-strand	66-71	6	12
β-strand	76	1	10
α-helix	77-94	18
α-helix	100-103	4
α-helix	107-117	11
β-strand	118-119	2	14
β-strand	122-123	2	14
α-helix	128-131	4
α-helix	148-150	3
α-helix	151-154	4
β-strand	170-183	14	9
β-strand	189-194	6	9
β-strand	197-203	7	9
β-strand	209	1	15
β-strand	210-214	5	16
β-strand	216	1	17
α-helix	217-223	7
β-strand	231	1	17
β-strand	235-238	4	9
β-strand	242	1	16
α-helix	244-250	7
β-strand	253-255	3	16
β-strand	260-270	11	9
α-helix	274-275	2
β-strand	277-280	4	18
β-strand	283	1	18
β-strand	290-299	10	18
β-strand	306-314	9	9
β-strand	321-326	6	18
β-strand	331-335	5	9
β-strand	340-349	10	9
β-strand	353-361	9	18
α-helix	366-367	2
α-helix	374-375	2
β-strand	376-377	2	9
β-strand	381-383	3	9
β-strand	385	1	5
β-strand	392-395	4	16
β-strand	398	1	15
β-strand	406-420	15	9

Chain N: 11 helices, 9 β-strands

Element	Residues	Length	Sheet
α-helix	7-22	16
β-strand	69	1	5
β-strand	77	1	6
α-helix	78-80	3
α-helix	81-94	14
α-helix	100	1
β-strand	101	1	7
α-helix	102	1
α-helix	104-118	15
β-strand	120	1	6
β-strand	127	1	8
α-helix	133	1
β-strand	134	1	7
α-helix	135	1
β-strand	136	1	8
β-strand	143-147	5	7
β-strand	181-185	5	7
α-helix	187-190	4
α-helix	194-198	5
α-helix	200-203	4

Chain S: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	19
β-strand	14-19	6	19
α-helix	25-40	16
β-strand	49-51	3	19
β-strand	56-58	3	19
β-strand	59	1	20
β-strand	66	1	19
β-strand	68	1	20
β-strand	69-71	3	19
α-helix	78-95	18
α-helix	100-105	6
α-helix	107-117	11
β-strand	118-119	2	21
β-strand	122-123	2	21
α-helix	129-140	12

Chain Y: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
β-strand	345	1	9
α-helix	352-354	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ADP-ribosylation factor 1	C, H	protein	181	Homo sapiens	P84077 (AlphaFold model)
Protein Nef	L, N	protein	213	Human immunodeficiency virus 1	Q90VU7
HLA class I histocompatibility antigen, A alpha chain	Y	protein	44	Homo sapiens	P04439 (AlphaFold model)
AP-1 complex subunit beta-1	B	protein	948	Homo sapiens	Q10567 (AlphaFold model)
AP-1 complex subunit gamma-1	G	protein	600	Mus musculus	P22892
AP-1 complex subunit mu-1	M	protein	422	Mus musculus	P35585
AP-1 complex subunit sigma-3	S	protein	154	Homo sapiens	Q96PC3

Sequence of entity 1 (C, H), FASTA

>7UX3_1 ADP-ribosylation factor 1 (chains C, H)
XGNIFANLFKGLFGKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKN
ISFTVWDVGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELRDAV
LLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLYEGLDWLSNQLRNQ
K

Sequence of entity 2 (L, N), FASTA

>7UX3_2 Protein Nef (chains L, N)
XGGKWSKSSVIGWPAVRERMRRAEPAADGVGAVSRDLEKHGAITSSNTAANNAACAWLEA
QEEEEVGFPVTPQVPLRPMTYKAAVDLSHFLKEKGGLEGLIHSQRRQDILDLWIYHTQGY
FPDWQNYTPGPGVRYPLTFGWCYKLVPVEPDKVEEANKGENTSLLHPVSLHGMDDPEREV
LEWRFDSRLAFHHVARELHPEYFKNCGHHHHHH

Sequence of entity 3 (Y), FASTA

>7UX3_3 HLA class I histocompatibility antigen, A alpha chain (chains Y)
GAMGSCRKSSDRKGGSYSQAAGSDSAQSSDVSLTAAKVHHHHHH

Sequence of entity 4 (B), FASTA

>7UX3_4 AP-1 complex subunit beta-1 (chains B)
TDSKYFTTTKKGEIFELKAELNSDKKEKKKEAVKKVIASMTVGKDVSALFPDVVNCMQTD
NLELKKLVYLYLMNYAKSQPDMAIMAVNTFVKDCEDPNPLIRALAVRTMGCIRVDKITEY
LCEPLRKCLKDEDPYVRKTAAVCVAKLHDINAQLVEDQGFLDTLKDLISDSNPMVVANAV
AALSEIAESHPSSNLLDLNPQSINKLLTALNECTEWGQIFILDCLANYMPKDDREAQSIC
ERVTPRLSHANSAVVLSAVKVLMKFMEMLSKDLDYYGTLLKKLAPPLVTLLSAEPELQYV
ALRNINLIVQKRPEILKHEMKVFFVKYNDPIYVKLEKLDIMIRLASQANIAQVLAELREY
ATEVDVDFVRKAVRAIGRCAIKVEQSAERCVSTLLDLIQTKVNYVVQEAIVVIKDIFRKY
PNKYESVIATLCENLDSLDEPEARAAMIWIVGEYAERIDNADELLESFLEGFHDKSTQVQ
LQLLTAIVKLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKEVV
LAEKPLISEETDLIEPTLLDELICYIGTLASVYHKPPSAFVEGGRGVVHKSLPPRTASSE
SAESPETAPTGAPPGEQPDVIPAQGDLLGDLLNLDLGPPVSGPPLATSSVQMGAVDLLGG
GLDSLMGDEPEGIGGTNFVAPPTAAVPANLGAPIGSGLSDLFDLTSGVGTLSGSYVAPKA
VWLPAMKAKGLEISGTFTRQVGSISMDLQLTNKALQVMTDFAIQFNRNSFGLAPAAPLQV
HAPLSPNQTVEISLPLSTVGSVMKMEPLNNLQVAVKNNIDVFYFSTLYPLHILFVEDGKM
DRQMFLATWKDIPNENEAQFQIRDCPLNAEAASSKLQSSNIFTVAKRNVEGQDMLYQSLK
LTNGIWVLAELRIQPGNPSCTDLELSLKCRAPEVSQHVYQAYETILKN

Sequence of entity 5 (G), FASTA

>7UX3_5 AP-1 complex subunit gamma-1 (chains G)
PAPIRLRELIRTIRTARTQAEEREMIQKECAAIRSSFREEDNTYRCRNVAKLLYMHMLGY
PAHFGQLECLKLIASQKFTDKRIGYLGAMLLLDERQDVHLLMTNCIKNDLNHSTQFVQGL
ALCTLGCMGSSEMCRDLAGEVEKLLKTSNSYLRKKAALCAVHVIRKVPELMEMFLPATKN
LLNEKNHGVLHTSVVLLTEMCERSPDMLAHFRKLVPQLVRILKNLIMSGYSPEHDVSGIS
DPFLQVRILRLLRILGRNDDDSSEAMNDILAQVATNTETSKNVGNAILYETVLTIMDIKS
ESGLRVLAINILGRFLLNNDKNIRYVALTSLLKTVQTDHNAVQRHRSTIVDCLKDLDVSI
KRRAMELSFALVNGNNIRGMMKELLYFLDSCEPEFKADCASGIFLAAEKYAPSKRWHIDT
IMRVLTTAGSYVRDDAVPNLIQLITNSVEMHAYTVQRLYKAILGDYSQQPLVQVAAWCIG
EYGDLLVSGQCEEEEPIQVTEDEVLDILESVLISNMSTSVTRGYALTAIMKLSTRFTCTV
NRIKKVVSIYGSSIDVELQQRAVEYNALFKKYDHMRSALLERMPVMEKVTTNGPENLYFQ

Sequence of entity 6 (M), FASTA

>7UX3_6 AP-1 complex subunit mu-1 (chains M)
SASAVYVLDLKGKVLICRNYRGDVDMSEVEHFMPILMEKEEEGMLSPILAHGGVRFMWIK
HNNLYLVATSKKNACVSLVFSFLYKVVQVFSEYFKELEEESIRDNFVIIYELLDELMDFG
YPQTTDSKILQEYITQEGHKLETGAPRPPATVTNAVSWRSEGIKYRKNEVFLDVIEAVNL
LVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQC
VRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMVKAKSQF
KRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSVKSFPGGKEYLMRAHFG
LPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLR
TQ

Sequence of entity 7 (S), FASTA

>7UX3_7 AP-1 complex subunit sigma-3 (chains S)
MIHFILLFSRQGKLRLQKWYITLPDKERKKITREIVQIILSRGHRTSSFVDWKELKLVYK
RYASLYFCCAIENQDNELLTLEIVHRYVELLDKYFGNVCELDIIFNFEKAYFILDEFIIG
GEIQETSKKIAVKAIEDSDMLQEVSTVSQTMGER

Ligands and cofactors

ID	Name	Formula	Copies
MG	Magnesium ion	Mg	2
GTP	Guanosine-5'-triphosphate	C10 H16 N5 O14 P3	2

Primary citation

Self-assembly and structure of a clathrin-independent AP-1:Arf1 tubular membrane coat. Hooy, R.M., Iwamoto, Y., Tudorica, D.A. et al. Sci Adv (2022) 8:eadd3914-eadd3914. DOI 10.1126/sciadv.add3914 · PubMed

Other PDB entries of the same protein (UniProt P84077 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8SDW 1.75 Å, Crystal structure of the non-myristoylated mutant [L8K]Arf1 in complex with a GDP analogue
1HUR 2.0 Å, Human ADP-ribosylation factor 1 complexed with GDP, full length non-myristoylated
7R4H 2.34 Å, phospho-STING binding to adaptor protein complex-1
6FAE 2.35 Å, The Sec7 domain of IQSEC2 (Brag1) in complex with the small GTPase Arf1
1RE0 2.4 Å, Structure of ARF1-GDP bound to Sec7 domain complexed with Brefeldin A
9QLO 2.47 Å, NMT1-NAC bound human RNC with full length ARF1 - State 1
9QLQ 2.57 Å, NMT1-NAC bound human RNC with full length ARF1 - alternative State
7DN8 2.61 Å, Crystal structure of Salmonella effector SopF in complex with ARF1
9QLP 2.75 Å, NMT1-NAC bound human RNC with full length ARF1 - State 2
3O47 2.8 Å, Crystal structure of ARFGAP1-ARF1 fusion protein
7DN9 3.29 Å, Crystal structure of Salmonella effector in complex with NAD and host co-factor ARF1
6CM9 3.73 Å, Structure of the cargo bound AP-1:Arf1:tetherin-Nef closed trimer monomeric subunit

Browse structure collections

About this viewer

MolViewer shows 7UX3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.