7UZM: Glutamate dehydrogenase 1 from human liver

Glutamate dehydrogenase 1 from human liver. Determined by electron microscopy at 3.24 Å resolution. Released 3 May 2023.

Method: Electron microscopy
Resolution: 3.24 Å
Organism: Homo sapiens
Chains: 6
Atoms: 22,752
Mol. weight: 368.88 kDa
Released: 3 May 2023

Explore 7UZM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7UZM contains 138 α-helices and 90 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D, E and F: 23 helices, 15 β-strands

Element	Residues	Length	Sheet
α-helix	66-88	23
α-helix	90-93	4
α-helix	99-109	11
β-strand	114-122	9	1
β-strand	130-138	9	1
β-strand	146-152	7	1
α-helix	158-174	17
β-strand	180-186	7	1
α-helix	195-211	17
β-strand	215-216	2	1
β-strand	220-224	5	1
α-helix	230-243	14
α-helix	250-253	4
α-helix	260-262	3
α-helix	264-265	2
α-helix	268-284	17
α-helix	287-293	7
β-strand	303-307	5	2
α-helix	311-323	13
β-strand	326-331	6	2
β-strand	336-338	3	2
α-helix	345-355	11
β-strand	365-366	2	2
α-helix	371-373	3
β-strand	378-381	4	2
β-strand	388	1	3
α-helix	392-395	4
β-strand	400-402	3	2
β-strand	409	1	3
α-helix	411-420	10
β-strand	423-425	3	2
α-helix	427-430	4
α-helix	433-447	15
α-helix	456-477	22
α-helix	489-490	2
α-helix	491-498	8
α-helix	502-527	26
α-helix	534-552	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glutamate dehydrogenase 1, mitochondrial	A, B, C, D, E, F	protein	558	Homo sapiens	P00367 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>7UZM_1 Glutamate dehydrogenase 1, mitochondrial (chains A, B, C, D, E, F)
MYRYLGEALLLSRAGPAALGSASADSAALLGWARGQPAAAPQPGLALAARRHYSEAVADR
EDDPNFFKMVEGFFDRGASIVEDKLVEDLRTRESEEQKRNRVRGILRIIKPCNHVLSLSF
PIRRDDGSWEVIEGYRAQHSQHRTPCKGGIRYSTDVSVDEVKALASLMTYKCAVVDVPFG
GAKAGVKINPKNYTDNELEKITRRFTMELAKKGFIGPGIDVPAPDMSTGEREMSWIADTY
ASTIGHYDINAHACVTGKPISQGGIHGRISATGRGVFHGIENFINEASYMSILGMTPGFG
DKTFVVQGFGNVGLHSMRYLHRFGAKCIAVGESDGSIWNPDGIDPKELEDFKLQHGSILG
FPKAKPYEGSILEADCDILIPAASEKQLTKSNAPRVKAKIIAEGANGPTTPEADKIFLER
NIMVIPDLYLNAGGVTVSYFEWLKNLNHVSYGRLTFKYERDSNYHLLMSVQESLERKFGK
HGGTIPIVPTAEFQDRISGASEKDIVHSGLAYTMERSARQIMRTAMKYNLGLDLRTAAYV
NAIEKVFKVYNEAGVTFT

Primary citation

High-resolution structural-omics of human liver enzymes. Su, C.C., Lyu, M., Zhang, Z. et al. Cell Rep (2023) 42:112609-112609. DOI 10.1016/j.celrep.2023.112609 · PubMed

Other PDB entries of the same protein (UniProt P00367 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8SK8 2.31 Å, human liver mitochondrial Glutamate dehydrogenase 1
8KGY 2.59 Å, Human glutamate dehydrogenase I
1L1F 2.7 Å, Structure of human glutamate dehydrogenase-apo form
6DQG 2.7 Å, Human glutamate dehydrogenase, H454Y mutant
8W4J 3.06 Å, Cryo-EM structure of the KLHL22 E3 ligase bound to human glutamate dehydrogenase I
1NR1 3.3 Å, Crystal structure of the R463A mutant of human Glutamate dehydrogenase

Browse structure collections

About this viewer

MolViewer shows 7UZM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.