7V8H: LRR domain from Shigella flexneri IpaH1.4

Name: PDB 7V8H: Crystal structure of LRR domain from Shigella flexneri IpaH1.4
Published: 2022-03-30
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Crystal structure of LRR domain from Shigella flexneri IpaH1.4. Determined by X-ray diffraction at 2.46 Å resolution. Released 30 Mar 2022.

Method: X-ray diffraction
Resolution: 2.46 Å
Organism: Shigella flexneri 5a str. M90T
Chains: 2
Atoms: 3,812
Mol. weight: 53.98 kDa
Released: 30 Mar 2022

Explore 7V8H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7V8H contains 22 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	39-50	12
α-helix	58-70	13
β-strand	75-77	3	1
α-helix	88-90	3
β-strand	95-97	3	1
α-helix	108-110	3
β-strand	115-117	3	1
α-helix	128-130	3
β-strand	135-137	3	1
α-helix	148-150	3
β-strand	155-157	3	1
α-helix	167-170	4
β-strand	175-177	3	1
α-helix	187-190	4
β-strand	195-197	3	1
α-helix	206-210	5
β-strand	215-217	3	1
α-helix	228-232	5
β-strand	238-240	3	1
α-helix	248-258	11
β-strand	267-269	3	1

Chain B: 11 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	39-50	12
α-helix	58-70	13
β-strand	75-77	3	2
α-helix	88-90	3
β-strand	95-97	3	2
α-helix	108-110	3
β-strand	115-117	3	2
α-helix	128-130	3
β-strand	135-137	3	2
α-helix	148-150	3
β-strand	155-157	3	2
α-helix	167-170	4
β-strand	175-177	3	2
α-helix	187-190	4
β-strand	195-197	3	2
α-helix	206-210	5
β-strand	215-217	3	2
α-helix	228-232	5
β-strand	238-240	3	2
α-helix	248-258	11
β-strand	268-269	2	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
RING-type E3 ubiquitin transferase	A, B	protein	240	Shigella flexneri 5a str. M90T	A0A0H2USG1 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7V8H_1 RING-type E3 ubiquitin transferase (chains A, B)
GPGSNEFYLKTWSEWEKNGTPGEQRNIAFNRLKICLQNQEAELNLSELDLKTLPDLPPQI
TTLEIRKNLLTHLPDLPPMLKVIHAQFNQLESLPALPETLEELNAGDNKIKELPFLPENL
THLRVHNNRLHILPLLPPELKLLVVSGNRLDSIPPFPDKLEGLALANNFIEQLPELPFSM
NRAVLMNNNLTTLPESVLRLAQNAFVNVAGNPLSGHTMRTLQQITTGPDYSGPRIFFSMG

Primary citation

Mechanistic insights into the subversion of the linear ubiquitin chain assembly complex by the E3 ligase IpaH1.4 of Shigella flexneri. Liu, J., Wang, Y., Wang, D. et al. Proc Natl Acad Sci U S A (2022) 119:e2116776119-e2116776119. DOI 10.1073/pnas.2116776119 · PubMed

Other PDB entries of the same protein (UniProt A0A0H2USG1 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7YA7 1.4 Å, The crystal structure of IpaH1.4 LRR domain
7V8E 1.9 Å, Crystal structure of IpaH1.4 LRR domain bound to HOIL-1L UBL domain.
7V8G 2.75 Å, Crystal structure of HOIP RING1 domain bound to IpaH1.4 LRR domain
9G08 3.3 Å, Structure of human RNF213 bound to the secreted effector IpaH1.4 from Shigella flexneri
9JWG 3.47 Å, Cryo-EM Focused Refined Map of Human RNF213 E3 module and IpaH1.4 LRR domain

Browse structure collections

About this viewer

MolViewer shows 7V8H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.