7VFI: Mouse TAPL

Cryo-EM structure of the mouse TAPL (9mer-peptide bound). Determined by electron microscopy at 3.98 Å resolution. Released 19 Oct 2022.

Method: Electron microscopy
Resolution: 3.98 Å
Organism: Mus musculus
Chains: 3
Atoms: 8,903
Mol. weight: 170.74 kDa
Ligands: Y01
Released: 19 Oct 2022

Explore 7VFI in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7VFI contains 50 α-helices and 34 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 27 helices, 16 β-strands

Element	Residues	Length	Sheet
α-helix	171-175	5
α-helix	178-180	3
α-helix	181-213	33
α-helix	219-226	8
α-helix	227-233	7
α-helix	234-265	32
α-helix	270-275	6
α-helix	278-294	17
α-helix	295-299	5
α-helix	300-320	21
α-helix	322-369	48
α-helix	371-375	5
α-helix	380-432	53
α-helix	438-479	42
α-helix	481-483	3
β-strand	500-501	2	1
β-strand	505	1	2
β-strand	521	1	2
β-strand	524-525	2	1
β-strand	531-533	3	3
α-helix	544-547	4
β-strand	560-561	2	1
β-strand	564-565	2	1
α-helix	571-577	7
β-strand	578	1	4
β-strand	591	1	5
α-helix	592-596	5
α-helix	605-615	11
α-helix	618-622	5
α-helix	627-629	3
β-strand	631	1	5
α-helix	633-636	4
α-helix	641-653	13
β-strand	659	1	4
β-strand	661-663	3	3
α-helix	673-677	5
α-helix	678-682	5
β-strand	691-693	3	3
β-strand	705-707	3	3
β-strand	708-710	3	6
β-strand	713-716	4	6
α-helix	720-725	6
α-helix	731-736	6

Chain B: 23 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	171-177	7
α-helix	178-180	3
α-helix	181-213	33
α-helix	218-266	49
α-helix	270-275	6
α-helix	279-294	16
α-helix	295-299	5
α-helix	300-320	21
α-helix	322-369	48
α-helix	371-377	7
α-helix	380-432	53
α-helix	438-472	35
β-strand	491	1	7
β-strand	500	1	8
β-strand	503-504	2	9
β-strand	505-508	4	10
β-strand	516-521	6	10
β-strand	530-532	3	11
β-strand	533	1	12
α-helix	543-548	6
β-strand	556-558	3	9
β-strand	560-561	2	8
β-strand	564-565	2	8
β-strand	569	1	7
α-helix	571-577	7
β-strand	591	1	13
α-helix	592-596	5
α-helix	605-614	10
α-helix	620-623	4
β-strand	631	1	13
α-helix	641-653	13
β-strand	659-663	5	11
α-helix	673-677	5
α-helix	678-682	5
β-strand	689-693	5	11
α-helix	697-699	3
β-strand	707	1	12
β-strand	708-709	2	14
β-strand	714-716	3	14
α-helix	720-725	6
α-helix	731-737	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ABC-type oligopeptide transporter ABCB9	A, B	protein	762	Mus musculus	Q9JJ59 (AlphaFold model)
Arg-arg-tyr-gln-lys-ser-thr-glu-leu	C	protein	9	Mus musculus	P68433 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7VFI_1 ABC-type oligopeptide transporter ABCB9 (chains A, B)
MRLWKAVVVTLAFVSTDVGVTTAIYAFSHLDRSLLEDIRHFNIFDSVLDLWAACLYRSCL
LLGATIGVAKNSALGPRRLRASWLVITLVCLFVGIYAMAKLLLFSEVRRPIRDPWFWALF
VWTYISLAASFLLWGLLATVRPDAEALEPGNEGFHGEGGAPAEQASGATLQKLLSYTKPD
VAFLVAASFFLIVAALGETFLPYYTGRAIDSIVIQKSMDQFTTAVVVVCLLAIGSSLAAG
IRGGIFTLVFARLNIRLRNCLFRSLVSQETSFFDENRTGDLISRLTSDTTMVSDLVSQNI
NIFLRNTVKVTGVVVFMFSLSWQLSLVTFMGFPIIMMVSNIYGKYYKRLSKEVQSALARA
STTAEETISAMKTVRSFANEEEEAEVFLRKLQQVYKLNRKEAAAYMSYVWGSGLTLLVVQ
VSILYYGGHLVISGQMSSGNLIAFIIYEFVLGDCMESVGSVYSGLMQGVGAAEKVFEFID
RQPTMVHDGSLAPDHLEGRVDFENVTFTYRTRPHTQVLQNVSFSLSPGKVTALVGPSGSG
KSSCVNILENFYPLQGGRVLLDGKPIGAYDHKYLHRVISLVSQEPVLFARSITDNISYGL
PTVPFEMVVEAAQKANAHGFIMELQDGYSTETGEKGAQLSGGQKQRVAMARALVRNPPVL
ILDEATSALDAESEYLIQQAIHGNLQRHTVLIIAHRLSTVERAHLIVVLDKGRVVQQGTH
QQLLAQGGLYAKLVQRQMLGLEHPLDYTASHKEPPSNTEHKA

Sequence of entity 2 (C), FASTA

>7VFI_2 ARG-ARG-TYR-GLN-LYS-SER-THR-GLU-LEU (chains C)
RRYQKSTEL

Ligands and cofactors

ID	Name	Formula	Copies
Y01	Cholesterol hemisuccinate	C31 H50 O4	3

Primary citation

The lysosomal transporter TAPL has a dual role as peptide translocator and phosphatidylserine floppase. Park, J.G., Kim, S., Jang, E. et al. Nat Commun (2022) 13:5851-5851. DOI 10.1038/s41467-022-33593-2 · PubMed

Other PDB entries of the same protein (UniProt Q9JJ59 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7V5C 3.2 Å, Cryo-EM structure of the mouse ABCB9 (ADP.BeF3-bound)
7V5D 3.4 Å, Cryo-EM structure of the mouse ABCB9 (PG-bound)

Browse structure collections

About this viewer

MolViewer shows 7VFI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.