Structure of Bat coronavirus RaTG13 spike receptor-binding domain complexed with its receptor equine ACE2. Determined by X-ray diffraction at 2.6 Å resolution. Released 8 Jun 2022.
Explore 7W6R in 3D Show helices and sheets RCSB PDB PDBe
7W6R contains 51 α-helices and 26 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 21-51 | 31 | |
| α-helix | 56-80 | 25 | |
| α-helix | 85-87 | 3 | |
| α-helix | 91-101 | 11 | |
| α-helix | 104-107 | 4 | |
| α-helix | 110-129 | 20 | |
| β-strand | 132-134 | 3 | 1 |
| β-strand | 137-142 | 6 | 1 |
| α-helix | 144-148 | 5 | |
| α-helix | 149-154 | 6 | |
| α-helix | 158-167 | 10 | |
| α-helix | 168-172 | 5 | |
| α-helix | 173-193 | 21 | |
| α-helix | 199-204 | 6 | |
| α-helix | 205-207 | 3 | |
| β-strand | 209 | 1 | 2 |
| β-strand | 217 | 1 | 2 |
| α-helix | 219-251 | 33 | |
| α-helix | 261 | 1 | |
| β-strand | 262-263 | 2 | 3 |
| α-helix | 264-266 | 3 | |
| α-helix | 276-278 | 3 | |
| α-helix | 279-282 | 4 | |
| α-helix | 294-299 | 6 | |
| α-helix | 304-317 | 14 | |
| α-helix | 320-324 | 5 | |
| α-helix | 325-330 | 6 | |
| β-strand | 332 | 1 | 4 |
| β-strand | 347-352 | 6 | 4 |
| β-strand | 355-359 | 5 | 4 |
| α-helix | 366-384 | 19 | |
| α-helix | 385-387 | 3 | |
| α-helix | 390-392 | 3 | |
| α-helix | 400-413 | 14 | |
| α-helix | 415-420 | 6 | |
| α-helix | 432-446 | 15 | |
| α-helix | 449-465 | 17 | |
| α-helix | 470-472 | 3 | |
| α-helix | 473-480 | 8 | |
| α-helix | 481-485 | 5 | |
| β-strand | 487-488 | 2 | 3 |
| α-helix | 499-502 | 4 | |
| α-helix | 504-507 | 4 | |
| α-helix | 514-532 | 19 | |
| α-helix | 539-541 | 3 | |
| α-helix | 548-558 | 11 | |
| α-helix | 566-574 | 9 | |
| α-helix | 582-587 | 6 | |
| α-helix | 589-599 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 335 | 1 | 5 |
| α-helix | 338-342 | 5 | |
| β-strand | 349 | 1 | 6 |
| α-helix | 350-352 | 3 | |
| β-strand | 354-358 | 5 | 6 |
| β-strand | 361-362 | 2 | 5 |
| α-helix | 366-369 | 4 | |
| β-strand | 376-379 | 4 | 6 |
| α-helix | 385-389 | 5 | |
| β-strand | 391-392 | 2 | 5 |
| β-strand | 394-403 | 10 | 6 |
| α-helix | 404-407 | 4 | |
| α-helix | 417-421 | 5 | |
| β-strand | 431-437 | 7 | 6 |
| α-helix | 439-442 | 4 | |
| β-strand | 448 | 1 | 7 |
| β-strand | 452-454 | 3 | 8 |
| α-helix | 460-462 | 3 | |
| α-helix | 471-472 | 2 | |
| β-strand | 473-474 | 2 | 9 |
| β-strand | 485 | 1 | 9 |
| β-strand | 488-489 | 2 | 9 |
| β-strand | 492-494 | 3 | 8 |
| β-strand | 497 | 1 | 7 |
| α-helix | 503-505 | 3 | |
| β-strand | 507-516 | 10 | 6 |
| β-strand | 524-525 | 2 | 5 |
| α-helix | 526-528 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Angiotensin-converting enzyme | A | protein | 602 | Equus caballus | A0A9L0TPT7 (AlphaFold model) |
| Spike glycoprotein | B | protein | 223 | Bat coronavirus RaTG13 | A0ABF7PLN6 |
>7W6R_1 Angiotensin-converting enzyme (chains A) STTEDLAKTFLEKFNSEAEELSHQSSLASWSYNTNITDENVQKMNEAGARWSAFYEEQCK LAKTYPLEEIQNLTVKRQLQALQQSGSSVLSADKSKRLNEILNTMSTIYSTGKVCNPSNP QECLLLEPGLDAIMENSKDYNQRLWAWEGWRSEVGKQLRPLYEEYVVLKNEMARANNYED YGDYWRGDYEAEGPSGYDYSRDQLIEDVERTFAEIKPLYEHLHAYVRAKLMDTYPSHINP TGCLPAHLLGDMWGRFWTNLYSLTVPFGQKPNIDVTDAMVDQSWDAKRIFEEAEKFFVSV GLPNMTQGFWENSMLTEPGDGRKVVCHPTAWDLGKGDFRIKMCTKVTMDDFLTAHHEMGH IQYDMAYAVQPYLLRNGANEGFHEAVGEIMSLSAATPNHLKAIGLLPPDFYEDSETEINF LLKQALTIVGTLPFTYMLEKWRWMVFKGEIPKEEWMKKWWEMKREIVGVVEPVPHDETYC DPAALFHVANDYSFIRYYTRTIYQFQFQEALCQTAKHEGPLHKCDISNSTEAGQKLLQML SLGKSEPWTLALERIVGVKNMDVRPLLNYFEPLFTWLKDQNKNSFVGWSTNWSPYAHHHH HH
>7W6R_2 Spike glycoprotein (chains B) RVQPTDSIVRFPNITNLCPFGEVFNATTFASVYAWNRKRISNCVADYSVLYNSTSFSTFK CYGVSPTKLNDLCFTNVYADSFVITGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNS KHIDAKEGGNFNYLYRLFRKANLKPFERDISTEIYQAGSKPCNGQTGLNCYYPLYRYGFY PTDGVGHQPYRVVVLSFELLNAPATVCGPKKSTNLVKNKCVNF
Binding and structural basis of equine ACE2 to RBDs from SARS-CoV, SARS-CoV-2 and related coronaviruses. Xu, Z., Kang, X., Han, P. et al. Nat Commun (2022) 13:3547. DOI 10.1038/s41467-022-31276-6
MolViewer shows 7W6R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.