Crystal structure of human Npl4. Determined by X-ray diffraction at 2.99 Å resolution. Released 21 Sept 2022.
Explore 7WWP in 3D Show helices and sheets RCSB PDB PDBe
7WWP contains 19 α-helices and 23 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 109-115 | 7 | |
| β-strand | 121 | 1 | 1 |
| β-strand | 144 | 1 | 1 |
| α-helix | 149-153 | 5 | |
| α-helix | 158-159 | 2 | |
| β-strand | 162-163 | 2 | 2 |
| α-helix | 164-170 | 7 | |
| α-helix | 211-212 | 2 | |
| β-strand | 213-215 | 3 | 3 |
| β-strand | 220-221 | 2 | 2 |
| β-strand | 225-228 | 4 | 4 |
| α-helix | 231-244 | 14 | |
| β-strand | 249-258 | 10 | 4 |
| β-strand | 266-274 | 9 | 4 |
| β-strand | 278-281 | 4 | 5 |
| β-strand | 284-287 | 4 | 5 |
| α-helix | 288-289 | 2 | |
| α-helix | 293-301 | 9 | |
| β-strand | 306-313 | 8 | 4 |
| β-strand | 317 | 1 | 6 |
| β-strand | 325 | 1 | 6 |
| α-helix | 338-350 | 13 | |
| β-strand | 352-354 | 3 | 7 |
| β-strand | 362-365 | 4 | 7 |
| β-strand | 368-374 | 7 | 4 |
| β-strand | 380-387 | 8 | 4 |
| α-helix | 389-396 | 8 | |
| β-strand | 400-403 | 4 | 8 |
| β-strand | 406-412 | 7 | 8 |
| β-strand | 424-427 | 4 | 3 |
| β-strand | 437-439 | 3 | 3 |
| β-strand | 443-444 | 2 | 8 |
| α-helix | 445-448 | 4 | |
| β-strand | 449-455 | 7 | 4 |
| α-helix | 470-473 | 4 | |
| α-helix | 477-479 | 3 | |
| α-helix | 485-494 | 10 | |
| α-helix | 500-504 | 5 | |
| α-helix | 507-515 | 9 | |
| α-helix | 526-534 | 9 | |
| α-helix | 537-544 | 8 | |
| α-helix | 547-561 | 15 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Nuclear protein localization protein 4 homolog | A | protein | 473 | Homo sapiens | Q8TAT6 (AlphaFold model) |
>7WWP_1 Nuclear protein localization protein 4 homolog (chains A) TSVPPGFKVFGAPNVVEDEIDQYLSKQDGKIYRSRDPQLCRHGPLGKCVHCVPLEPFDED YLNHLEPPVKHMSFHAYIRKLTGGADKGKFVALENISCKIKSGCEGHLPWPNGICTKCQP SAITLNRQKYRHVDNIMFENHTVADRFLDFWRKTGNQHFGYLYGRYTEHKDIPLGIRAEV AAIYEPPQIGTQNSLELLEDPKAEVVDEIAAKLGLRKVGWIFTDLVSEDTRKGTVRYSRN KDTYFLSSEECITAGDFQNKHPNMCRLSPDGHFGSKFVTAVATGGPDNQVHFEGYQVSNQ CMALVRDECLLPCKDAPELGYAKESSSEQYVPDVFYKDVDKFGNEITQLARPLPVEYLII DITTTFPKDPVYTFSISQNPFPIENRDVLGETQDFHSLATYLSQNTSSVFLDTISDFHLL LFLVTNEVMPLQDSISLLLEAVRTRNEELAQTWKRSEQWATIEQLCSTVGLEA
| ID | Name | Formula | Copies |
|---|---|---|---|
| ZN | Zinc ion | Zn | 1 |
Structural basis for the interaction between human Npl4 and Npl4-binding motif of human Ufd1. Nguyen, T.Q., My Le, L.T., Kim, D.H. et al. Structure (2022) 30:1530-1537.e3. DOI 10.1016/j.str.2022.08.005 · PubMed
Other PDB entries of the same protein (UniProt Q8TAT6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7WWP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.