7X1R: Human thioredoxin reductase bound by Au

Cryo-EM structure of human thioredoxin reductase bound by Au. Determined by electron microscopy at 3.9 Å resolution. Released 14 Dec 2022.

Method: Electron microscopy
Resolution: 3.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 7,608
Mol. weight: 114.2 kDa
Ligands: AU, FAD
Released: 14 Dec 2022

Explore 7X1R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7X1R contains 40 α-helices and 60 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 20 helices, 30 β-strands

Element	Residues	Length	Sheet
β-strand	13-18	6	1
α-helix	22-33	12
β-strand	38-41	4	1
α-helix	45-47	3
α-helix	57-62	6
α-helix	64-83	20
β-strand	88	1	2
β-strand	96	1	3
α-helix	98-122	25
β-strand	126-128	3	1
β-strand	130-136	7	4
β-strand	139-144	6	4
β-strand	149-153	5	4
β-strand	154-159	6	1
β-strand	163-165	3	5
α-helix	173-176	4
β-strand	178-179	2	6
α-helix	180-183	4
β-strand	193-196	4	6
α-helix	200-211	12
β-strand	216-219	4	6
α-helix	230-242	13
β-strand	246-248	3	6
β-strand	251-260	10	7
β-strand	266-273	8	7
β-strand	279-284	6	7
β-strand	286-289	4	6
β-strand	293-295	3	5
α-helix	302-304	3
β-strand	316	1	8
β-strand	323	1	1
β-strand	329-331	3	1
β-strand	336	1	8
α-helix	343-358	16
α-helix	363-365	3
β-strand	372-374	3	9
β-strand	380-384	5	9
α-helix	387-394	8
α-helix	396-398	3
β-strand	399-405	7	9
α-helix	409-411	3
β-strand	422-428	7	9
α-helix	429-431	3
β-strand	434-441	8	9
α-helix	445-457	13
β-strand	461	1	9
α-helix	462-467	6
α-helix	469-471	3
α-helix	475-480	6
β-strand	485	1	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Thioredoxin reductase 1, cytoplasmic	A, B	protein	510	Homo sapiens	Q16881

Sequence of entity 1 (A, B), FASTA

>7X1R_1 Thioredoxin reductase 1, cytoplasmic (chains A, B)
MWSHPQFEKLGSNGPEDLPKSYDYDLIIIGGGSGGLAAAKEAAQYGKKVMVLDFVTPTPL
GTRWGLGGTCVNVGCIPKKLMHQAALLGQALQDSRNYGWKVEETVKHDWDRMIEAVQNHI
GSLNWGYRVALREKKVVYENAYGQFIGPHRIKATNNKGKEKIYSAERFLIATGERPRYLG
IPGDKEYCISSDDLFSLPYCPGKTLVVGASYVALECAGFLAGIGLDVTVMVRSILLRGFD
QDMANKIGEHMEEHGIKFIRQFVPIKVEQIEAGTPGRLRVVAQSTNSEEIIEGEYNTVML
AIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKVELTPVAIQA
GRLLAQRLYAGSTVKCDYENVPTTVFTPLEYGACGLSEEKAVEKFGEENIEVYHSYFWPL
EWTIPSRDNNKCYAKIICNTKDNERVVGFHVLGPNAGEVTQGFAAALKCGLTKKQLDSTI
GIHPVCAEVFTTLSVTKRSGASILQAGCUG

Ligands and cofactors

ID	Name	Formula	Copies
AU	Gold ion	Au	2
FAD	Flavin-adenine dinucleotide	C27 H33 N9 O15 P2	2

Primary citation

Au4 cluster inhibits human thioredoxin reductase activity via specifically binding of Au to Cys189. Du, Z., He, Z., Fan, J. et al. Nano Today (2022) 47:101686. DOI 10.1016/j.nantod.2022.101686

Other PDB entries of the same protein (UniProt Q16881), best resolution first:

3QFA 2.2 Å, Crystal structure of the human thioredoxin reductase-thioredoxin complex
2ZZC 2.6 Å, Crystal structure of NADP(H):human thioredoxin reductase I
3QFB 2.6 Å, Crystal structure of the human thioredoxin reductase-thioredoxin complex
2CFY 2.7 Å, Crystal structure of human thioredoxin reductase 1
2J3N 2.8 Å, X-ray structure of human thioredoxin reductase 1
2ZZ0 2.8 Å, Crystal structure of human thioredoxin reductase I (SeCys 498 Cys)
9UIN 3.03 Å, Human thioredoxin reductase 1 (SeCys 498 Cys) with Cu(I)
2ZZB 3.2 Å, Crystal structure of human thioredoxin reductase I and terpyridine platinum(II)

Browse structure collections

About this viewer

MolViewer shows 7X1R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.