7XCE: Ankyrin G

Crystal structure of Ankyrin G in complex with neurofascin. Determined by X-ray diffraction at 2.5 Å resolution. Released 21 Sept 2022.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Rattus norvegicus
Chains: 1
Atoms: 1,842
Mol. weight: 28.89 kDa
Released: 21 Sept 2022

Explore 7XCE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7XCE contains 15 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	252-254	3
α-helix	279-286	8
α-helix	289-297	9
α-helix	312-318	7
α-helix	322-330	9
α-helix	345-351	7
α-helix	355-363	9
α-helix	378-385	8
α-helix	388-396	9
α-helix	411-417	7
α-helix	421-429	9
α-helix	444-451	8
α-helix	454-462	9
α-helix	477-484	8
α-helix	487-495	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neurofascin,Ankyrin-3	A	protein	268	Rattus norvegicus	O70511 (AlphaFold model), P97685 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7XCE_1 Neurofascin,Ankyrin-3 (chains A)
GPGSEFSDDSLVDYGEGGEGQFNEDGSFIGQYTVGSLVPRGSNDITPLHVASKRGNANMV
KLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRAAPILSKTKNGLSPLHMATQG
DHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKANPNAKALNGFTPL
HIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNV
RGETALHMAARSGQAEVVRYLVQDGAQV

Primary citation

Crystal structure of Ankyrin-G in complex with a fragment of Neurofascin reveals binding mechanisms required for integrity of the axon initial segment. He, L., Jiang, W., Li, J. et al. J Biol Chem (2022) 298:102272-102272. DOI 10.1016/j.jbc.2022.102272 · PubMed

Other PDB entries of the same protein (UniProt O70511 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5YIP 1.85 Å, Crystal Structure of AnkG LIR/GABARAPL1 complex
6A9X 2.2 Å, Crystal Structure of AnkG/GABARAP Complex
5YIQ 2.6 Å, Crystal structure of AnkG LIR/LC3B complex
6M3P 3.31 Å, Crystal structure of AnkG/beta2-spectrin complex
6M3R 4.31 Å, Crystal structure of AnkG/beta4-spectrin complex

Browse structure collections

About this viewer

MolViewer shows 7XCE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.