7XT6: Membrane protein M3

Structure of a membrane protein M3. Determined by electron microscopy at 3.63 Å resolution. Released 31 Aug 2022.

Method: Electron microscopy
Resolution: 3.63 Å
Organism: Homo sapiens
Chains: 4
Atoms: 8,040
Mol. weight: 116.58 kDa
Ligands: NAG
Released: 31 Aug 2022

Explore 7XT6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7XT6 contains 25 α-helices and 93 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	41-44	4	1
β-strand	50-51	2	2
β-strand	63-69	7	3
α-helix	77-78	2
β-strand	79-83	5	3
β-strand	92-93	2	2
β-strand	102	1	1
β-strand	103-109	7	3
β-strand	116-117	2	3
β-strand	122-125	4	1
α-helix	138-155	18
α-helix	158-168	11

Chain B: 9 helices, 36 β-strands

Element	Residues	Length	Sheet
β-strand	248-249	2	4
β-strand	252	1	5
α-helix	253-255	3
β-strand	260-261	2	5
β-strand	264-270	7	5
β-strand	272-273	2	4
β-strand	275	1	6
β-strand	282-286	5	7
β-strand	289-290	2	7
β-strand	301-303	3	6
β-strand	311-313	3	6
β-strand	316-321	6	5
α-helix	322-326	5
β-strand	331-337	7	7
β-strand	340-344	5	7
β-strand	361-363	3	8
α-helix	368-371	4
β-strand	378	1	9
β-strand	379-385	7	8
β-strand	394-396	3	10
β-strand	402	1	10
β-strand	407	1	8
β-strand	418-421	4	8
β-strand	424	1	9
α-helix	428-433	6
β-strand	437	1	11
β-strand	438-440	3	10
β-strand	454	1	11
β-strand	463	1	12
β-strand	466-470	5	13
α-helix	471-473	3
α-helix	474-477	4
β-strand	482-490	9	13
β-strand	493	1	12
β-strand	498-500	3	14
β-strand	502-503	2	15
β-strand	506-507	2	15
α-helix	508-509	2
β-strand	519-520	2	13
β-strand	528-529	2	13
β-strand	532-537	6	13
α-helix	538-541	4
β-strand	547-552	6	14
β-strand	561-565	5	14
α-helix	582-606	25

Chain C: 1 helix, 15 β-strands

Element	Residues	Length	Sheet
β-strand	47-49	3	16
β-strand	53-56	4	17
β-strand	61-66	6	16
β-strand	75-76	2	18
β-strand	77-78	2	19
β-strand	79	1	20
β-strand	87-88	2	19
β-strand	93	1	21
β-strand	95	1	21
β-strand	97-100	4	16
β-strand	105-109	5	16
β-strand	119	1	20
β-strand	122-125	4	18
β-strand	132-134	3	18
β-strand	140-143	4	17
α-helix	148-180	33

Chain D: 12 helices, 33 β-strands

Element	Residues	Length	Sheet
β-strand	248-252	5	22
β-strand	260	1	22
β-strand	265-273	9	22
β-strand	275	1	23
β-strand	280-286	7	24
β-strand	289	1	24
β-strand	295	1	22
α-helix	297-299	3
β-strand	301-302	2	23
α-helix	303	1
β-strand	312-313	2	23
β-strand	315-321	7	22
α-helix	322-325	4
β-strand	330	1	25
β-strand	331-337	7	24
β-strand	340-344	5	24
β-strand	347	1	25
β-strand	360-363	4	26
α-helix	364-366	3
α-helix	367-373	7
β-strand	377-385	9	26
β-strand	392-396	5	27
β-strand	412	1	26
β-strand	418-425	8	26
α-helix	429-432	4
β-strand	437	1	28
β-strand	438-442	5	27
β-strand	454	1	28
β-strand	463	1	29
β-strand	466-470	5	30
α-helix	471-473	3
α-helix	474-479	6
β-strand	482-492	11	30
β-strand	493	1	29
β-strand	498-503	6	31
β-strand	506-507	2	31
α-helix	508-509	2
β-strand	513-515	3	30
α-helix	516-518	3
β-strand	519-520	2	30
β-strand	528-537	10	30
α-helix	538-541	4
β-strand	548-552	5	31
β-strand	561-563	3	31
α-helix	577-607	31

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
B-cell antigen receptor complex-associated protein alpha chain	A	protein	137	Homo sapiens	P11912 (AlphaFold model)
Isoform 2 of Immunoglobulin heavy constant mu	B, D	protein	364	Homo sapiens	P01871 (AlphaFold model)
B-cell antigen receptor complex-associated protein beta chain	C	protein	139	Homo sapiens	P40259 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7XT6_1 B-cell antigen receptor complex-associated protein alpha chain (chains A)
LWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPGEDPNGTLI
IQNVNKSHGGIYVCRVQEGNESYQQSCGTYLRVRQPPPRPFLDMGEGTKNRIITAEGIIL
LFCAVVPGTLLLFRKRW

Sequence of entity 2 (B, D), FASTA

>7XT6_2 Isoform 2 of Immunoglobulin heavy constant mu (chains B, D)
LPPKVSVFVPPRDGFFGNPRKSKLICQATGFSPRQIQVSWLREGKQVGSGVTTDQVQAEA
KESGPTTYKVTSTLTIKESDWLGQSMFTCRVDHRGLTFQQNASSMCVPDQDTAIRVFAIP
PSFASIFLTKSTKLTCLVTDLTTYDSVTISWTRQNGEAVKTHTNISESHPNATFSAVGEA
SICEDDWNSGERFTCTVTHTDLPSPLKQTISRPKGVALHRPDVYLLPPAREQLNLRESAT
ITCLVTGFSPADVFVQWMQRGQPLSPEKYVTSAPMPEPQAPGRYFAHSILTVSEEEWNTG
ETYTCVVAHEALPNRVTERTVDKSTEGEVSADEEGFENLWATASTFIVLFLLSLFYSTTV
TLFK

Sequence of entity 3 (C), FASTA

>7XT6_3 B-cell antigen receptor complex-associated protein beta chain (chains C)
SRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNES
LATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKDGIIM
IQTLLIILFIIVPIFLLLD

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	12

Primary citation

Cryo-EM structures of two human B cell receptor isotypes. Ma, X., Zhu, Y., Chen, Y. et al. Science (2022) 377:880-885. DOI 10.1126/science.abo3828 · PubMed

Other PDB entries of the same protein (UniProt P11912 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7WSO 3.03 Å, Structure of a membrane protein G
7XQ8 3.3 Å, Structure of human B-cell antigen receptor of the IgM isotype
7WSP 4.09 Å, Structure of a membrane protein M
9E6G 4.4 Å, Locally Refined Cryo-EM map of 2G12 IgG BCR receptor lacking Fab region view
1CV9 NMR study of itam peptide substrate

Browse structure collections

About this viewer

MolViewer shows 7XT6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.