7XXE: SpFft3 C-terminal truncation

Crystal structure of spFft3 C-terminal truncation. Determined by X-ray diffraction at 4.2 Å resolution. Released 6 Dec 2023.

Method: X-ray diffraction
Resolution: 4.2 Å
Organism: Schizosaccharomyces pombe 972h-
Chains: 2
Atoms: 4,409
Mol. weight: 64.76 kDa
Released: 6 Dec 2023

Explore 7XXE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7XXE contains 19 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	631-633	3	2
α-helix	637-644	8
α-helix	679-690	12
α-helix	701-709	9
α-helix	722-730	9
α-helix	736-742	7
α-helix	763-771	9
β-strand	781-782	2	3
α-helix	787-792	6
β-strand	805	1	3
α-helix	831	1
β-strand	832-833	2	3
β-strand	850-851	2	4
β-strand	852	1	3
β-strand	880-881	2	4
β-strand	884-886	3	2
α-helix	892-894	3

Chain B: 10 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	627-629	3	1
α-helix	637-645	9
α-helix	680-688	9
α-helix	692-694	3
α-helix	703-709	7
α-helix	724-730	7
α-helix	738-741	4
α-helix	761-769	9
α-helix	771-773	3
β-strand	780-783	4	1
α-helix	787-794	8
β-strand	806	1	1
β-strand	832-833	2	1
β-strand	850-853	4	1
β-strand	880-883	4	1
α-helix	890-894	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
ATP-dependent helicase fft3	A, B	protein	278	Schizosaccharomyces pombe 972h-	O42861 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7XXE_1 ATP-dependent helicase fft3 (chains A, B)
KTRIIEFCEFSEEERRRYDDFASKQSVNSLLDENVMKTNLDTNANLAKKKSTAGFVLVQL
RKLADHPMLFRIHYKDDILRQMAKAIMNEPQYKKANELYIFEDMQYMSDIELHNLCCKFP
SINSFQLKDEPWMDATKVRKLKKLLTNAVENGDRVVLFSQFTQVLDILQLVMKSLNLKFL
RFDGSTQVDFRQDLIDQFYADESINVFLLSTKAGGFGINLACANMVILYDVSFNPFDDLQ
AEDRAHRVGQKKEVTVYKFVVKDTIEEHIQRLANAKIA

Primary citation

Crystal structure of spFft3 C-terminal truncation. Nan, Z., Tao, J., Yangao, H. To be published.

Other PDB entries of the same protein (UniProt O42861 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7XWY 2.25 Å, Crystal structure of spFft3 N-terminal truncation
7XYF 3.8 Å, Cryo-EM structure of Fft3-nucleosome complex with Fft3 bound to SHL+2 position of the…
7XYG 4.2 Å, Cryo-EM structure of Fft3-nucleosome complex with Fft3 bound to SHL+3 position of the…

Browse structure collections

About this viewer

MolViewer shows 7XXE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.