7Z0E: M state of bacteriorhodopsin

Crystal structure of the M state of bacteriorhodopsin at 1.22 Angstrom resolution. Determined by X-ray diffraction at 1.22 Å resolution. Released 18 May 2022.

Method: X-ray diffraction
Resolution: 1.22 Å
Organism: Halobacterium salinarum
Chains: 1
Atoms: 3,241
Mol. weight: 33.87 kDa
Ligands: SQL, L2P, LFA, OLC
Released: 18 May 2022

Explore 7Z0E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7Z0E contains 12 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain P: 12 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	10-30	21
α-helix	37-61	25
β-strand	67-71	5	1
β-strand	74-78	5	1
α-helix	81-100	20
α-helix	105-127	23
α-helix	131-154	24
α-helix	165-182	18
α-helix	184-191	8
α-helix	201-213	13
α-helix	214-218	5
α-helix	219-224	6
α-helix	227-229	3
α-helix	231-232	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bacteriorhodopsin	P	protein	248	Halobacterium salinarum	P02945 (AlphaFold model)

Sequence of entity 1 (P), FASTA

>7Z0E_1 Bacteriorhodopsin (chains P)
QAQITGRPEWIWLALGTALMGLGTLYFLVKGMGVSDPDAKKFYAITTLVPAIAFTMYLSM
LLGYGLTMVPFGGEQNPIYWARYADWLFTTPLLLLDLALLVDADQGTILALVGADGIMIG
TGLVGALTKVYSYRFVWWAISTAAMLYILYVLFFGFTSKAESMRPEVASTFKVLRNVTVV
LWSAYPVVWLIGSEGAGIVPLNIETLLFMVLDVSAKVGFGLILLRSRAIFGEAEAPEPSA
GDGAAATS

Ligands and cofactors

ID	Name	Formula	Copies
SQL	(6E,10E,14E,18E)-2,6,10,15,19,23-hexamethyltetracosa-2,6,10,14,18,22-hexaene	C30 H50	1
L2P	2,3-di-phytanyl-glycerol	C43 H88 O3	1
LFA	Eicosane	C20 H42	19
OLC	(2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate	C21 H40 O4	1

Primary citation

True-atomic-resolution insights into the structure and functional role of linear chains and low-barrier hydrogen bonds in proteins. Borshchevskiy, V., Kovalev, K., Round, E. et al. Nat Struct Mol Biol (2022) 29:440-450. DOI 10.1038/s41594-022-00762-2 · PubMed

Other PDB entries of the same protein (UniProt P02945 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Z09 1.05 Å, Crystal structure of the ground state of bacteriorhodopsin at 1.05 Angstrom resolution
7Z0D 1.2 Å, Crystal structure of the L state of bacteriorhodopsin at 1.20 Angstrom resolution
7Z0A 1.22 Å, Crystal structure of the ground state of bacteriorhodopsin at 1.22 Angstrom resolution
5ZIM 1.25 Å, Crystal structure of bacteriorhodopsin at 1.25 A resolution
5ZIN 1.27 Å, Crystal structure of bacteriorhodopsin at 1.27 A resolution
5ZIL 1.29 Å, Crystal structure of bacteriorhodopsin at 1.29 A resolution
7XJC 1.33 Å, Crystal structure of bacteriorhodopsin in the ground and K states after green laser…
7XJD 1.33 Å, Crystal structure of bacteriorhodopsin in the ground state by red laser irradiation
7XJE 1.33 Å, Crystal structure of bacteriorhodopsin in the K state refined against the extrapolated…
1M0K 1.43 Å, Bacteriorhodopsin K intermediate at 1.43 a resolution
1M0M 1.43 Å, Bacteriorhodopsin M1 intermediate at 1.43 a resolution
9F9G 1.44 Å, Laser excitation effects on BR: Reprocessed Dark from Nogly et al.

Browse structure collections

About this viewer

MolViewer shows 7Z0E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.