7Z5H: Human Zn MATCAP

human Zn MATCAP. Determined by X-ray diffraction at 2.5 Å resolution. Released 11 May 2022.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Homo sapiens
Chains: 4
Atoms: 11,011
Mol. weight: 156.27 kDa
Ligands: ZN
Released: 11 May 2022

Explore 7Z5H in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7Z5H contains 108 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, C and D: 27 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	148-157	10
β-strand	165	1	1
α-helix	172	1
α-helix	174-179	6
α-helix	188-202	15
α-helix	205-213	9
β-strand	216	1	2
α-helix	217-218	2
α-helix	219-233	15
β-strand	240-244	5	3
β-strand	251-256	6	3
β-strand	259-265	7	3
β-strand	270	1	2
α-helix	271-280	10
α-helix	281-286	6
α-helix	287-293	7
α-helix	300-306	7
α-helix	308-310	3
α-helix	314-323	10
α-helix	333-345	13
α-helix	350-356	7
α-helix	357-359	3
α-helix	364-374	11
β-strand	380	1	1
α-helix	388-391	4
α-helix	392-402	11
α-helix	409-414	6
α-helix	420-422	3
α-helix	423-426	4
α-helix	427-429	3
α-helix	435-438	4
α-helix	439-441	3
α-helix	444-457	14
α-helix	462-468	7

Chain B: 27 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	148-157	10
β-strand	165	1	4
α-helix	172	1
α-helix	174-179	6
α-helix	188-202	15
α-helix	205-213	9
β-strand	216	1	5
α-helix	217-218	2
α-helix	219-233	15
β-strand	240-244	5	6
β-strand	251-256	6	6
β-strand	259-265	7	6
β-strand	270	1	5
α-helix	271-280	10
α-helix	281-286	6
α-helix	287-293	7
α-helix	300-305	6
α-helix	308-310	3
α-helix	314-323	10
α-helix	333-345	13
α-helix	350-356	7
α-helix	357-359	3
α-helix	364-374	11
β-strand	380	1	4
α-helix	388-391	4
α-helix	392-402	11
α-helix	409-414	6
α-helix	420-422	3
α-helix	423-426	4
α-helix	427-429	3
α-helix	435-438	4
α-helix	439-441	3
α-helix	444-457	14
α-helix	462-468	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Uncharacterized protein KIAA0895-like	A, B, C, D	protein	335	Homo sapiens	Q68EN5 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7Z5H_1 Uncharacterized protein KIAA0895-like (chains A, B, C, D)
PCMLVALRPTNMDRERDKFFQSHYTYNPQFEYQEPMPTAVLEKYCEASGQFIHQAVGIIE
AVLEKFGTYEHFEAATGGQLLTKCQIWSIVRKYMQKEGCAGEVVVQLSEDLLSQAVMMVE
NSRPTLAINLTGARQYWLEGMLRHEIGTHYLRGVNNARQPWHNAEGRLRYGLRPANPTEE
GLASLHSVLFRKQPFLWRAALLYYTIHRAARMSFRQLFQDLERYVQDADVRWEYCVRAKR
GQTDTSLPGCFSKDQVYLDGIVRILRHRQTIDFPLLTSLGKVSYEDVDHLRPHGVLDNTR
VPHFMQDLARYRQQLEHIMATNRLDEAELGRLLPD

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	4

Primary citation

Posttranslational modification of microtubules by the MATCAP detyrosinase. Landskron, L., Bak, J., Adamopoulos, A. et al. Science (2022) 376:eabn6020-eabn6020. DOI 10.1126/science.abn6020 · PubMed

Other PDB entries of the same protein (UniProt Q68EN5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Z5G 2.11 Å, human apo MATCAP
7Z6S 2.9 Å, MATCAP bound to a human 14 protofilament microtubule

Browse structure collections

About this viewer

MolViewer shows 7Z5H directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.