7ZAV: Glypican-3

GPC3-Unc5D octamer structure and role in cell migration. Determined by X-ray diffraction at 2.9 Å resolution. Released 2 Nov 2022.

Method: X-ray diffraction
Resolution: 2.9 Å
Organism: Mus musculus
Chains: 1
Atoms: 2,786
Mol. weight: 53.77 kDa
Ligands: NAG
Released: 2 Nov 2022

Explore 7ZAV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ZAV contains 19 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	75-132	58
α-helix	134-136	3
α-helix	139-155	17
α-helix	162-177	16
α-helix	178-182	5
α-helix	194-203	10
α-helix	210-242	33
α-helix	249-259	11
α-helix	261-264	4
β-strand	272	1	1
β-strand	273	1	2
α-helix	274-284	11
α-helix	286-289	4
α-helix	291-306	16
α-helix	316-319	4
α-helix	322-334	13
α-helix	337-347	11
α-helix	383-394	12
α-helix	395-397	3
α-helix	404-411	8
β-strand	415	1	2
β-strand	419-422	4	1
β-strand	427-430	4	1
α-helix	456-475	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glypican-3	A	protein	464	Mus musculus	Q8CFZ4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7ZAV_1 Glypican-3 (chains A)
ETGDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGPTCCSRKMEEKYQLTARLN
MEQLLQSASMELKFLIIQNAAVFQEAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEF
FTDVSLYILGSDINVDDMVNELFDSLFPVIYTQMMNPGLPESVLDINECLRGARRDLKVF
GSFPKLIMTQVSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGL
MMVKPCGGYCNVVMQGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIH
DSIQYVQKNGGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKILKVAHVEHEETLSSRR
RELIQKLKSFINFYSALPGYICSHSPVAENDTLCWNGQELVERYSQKAARNGMKNQFNLH
ELKMKGPEPVVSQIIDKLKHINQLLRTMSVPKGKVGTKHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

GPC3-Unc5 receptor complex structure and role in cell migration. Akkermans, O., Delloye-Bourgeois, C., Peregrina, C. et al. Cell (2022) 185:3931-3949.e26. DOI 10.1016/j.cell.2022.09.025 · PubMed

Other PDB entries of the same protein (UniProt Q8CFZ4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ZA3 4.0 Å, GPC3-Unc5D octamer structure and role in cell migration
7ZA2 4.6 Å, GPC3-Unc5D octamer structure and role in cell migration

Browse structure collections

About this viewer

MolViewer shows 7ZAV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.