GPC3-Unc5D octamer structure and role in cell migration. Determined by X-ray diffraction at 2.9 Å resolution. Released 2 Nov 2022.
Explore 7ZAV in 3D Show helices and sheets RCSB PDB PDBe
7ZAV contains 19 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 75-132 | 58 | |
| α-helix | 134-136 | 3 | |
| α-helix | 139-155 | 17 | |
| α-helix | 162-177 | 16 | |
| α-helix | 178-182 | 5 | |
| α-helix | 194-203 | 10 | |
| α-helix | 210-242 | 33 | |
| α-helix | 249-259 | 11 | |
| α-helix | 261-264 | 4 | |
| β-strand | 272 | 1 | 1 |
| β-strand | 273 | 1 | 2 |
| α-helix | 274-284 | 11 | |
| α-helix | 286-289 | 4 | |
| α-helix | 291-306 | 16 | |
| α-helix | 316-319 | 4 | |
| α-helix | 322-334 | 13 | |
| α-helix | 337-347 | 11 | |
| α-helix | 383-394 | 12 | |
| α-helix | 395-397 | 3 | |
| α-helix | 404-411 | 8 | |
| β-strand | 415 | 1 | 2 |
| β-strand | 419-422 | 4 | 1 |
| β-strand | 427-430 | 4 | 1 |
| α-helix | 456-475 | 20 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glypican-3 | A | protein | 464 | Mus musculus | Q8CFZ4 (AlphaFold model) |
>7ZAV_1 Glypican-3 (chains A) ETGDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGPTCCSRKMEEKYQLTARLN MEQLLQSASMELKFLIIQNAAVFQEAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEF FTDVSLYILGSDINVDDMVNELFDSLFPVIYTQMMNPGLPESVLDINECLRGARRDLKVF GSFPKLIMTQVSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGL MMVKPCGGYCNVVMQGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIH DSIQYVQKNGGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKILKVAHVEHEETLSSRR RELIQKLKSFINFYSALPGYICSHSPVAENDTLCWNGQELVERYSQKAARNGMKNQFNLH ELKMKGPEPVVSQIIDKLKHINQLLRTMSVPKGKVGTKHHHHHH
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
GPC3-Unc5 receptor complex structure and role in cell migration. Akkermans, O., Delloye-Bourgeois, C., Peregrina, C. et al. Cell (2022) 185:3931-3949.e26. DOI 10.1016/j.cell.2022.09.025 · PubMed
Other PDB entries of the same protein (UniProt Q8CFZ4 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7ZAV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.