7ZCH: CHMP2A-CHMP3 heterodimer

CHMP2A-CHMP3 heterodimer (410 Angstrom diameter). Determined by electron microscopy at 3.6 Å resolution. Released 18 Jan 2023.

Method: Electron microscopy
Resolution: 3.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,468
Mol. weight: 35.74 kDa
Released: 18 Jan 2023

Explore 7ZCH in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ZCH contains 7 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	12-53	42
α-helix	58-115	58
α-helix	120-148	29
α-helix	155-168	14

Chain B: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	11-50	40
α-helix	58-114	57
α-helix	119-150	32

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Charged multivesicular body protein 2a	B	protein	147	Homo sapiens	O43633 (AlphaFold model)
Charged multivesicular body protein 3	A	protein	159	Homo sapiens	Q9Y3E7 (AlphaFold model)

Sequence of entity 1 (B), FASTA

>7ZCH_1 Charged multivesicular body protein 2a (chains B)
RKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLV
RTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMM
EFERQAEIMDMKEEMMNDAIDDAMGDE

Sequence of entity 2 (A), FASTA

>7ZCH_2 Charged multivesicular body protein 3 (chains A)
PPKELVNEWSLKIRKEMRVVDRQIRDIQREEEKVKRSVKDAAKKGQKDVCIVLAKEMIRS
RKAVSKLYASKAHMNSVLMGMKNQLAVLRVAGSLQKSTEVMKAMQSLVKIPEIQATMREL
SKEMMKAGIIEEMLEDTFESMDDQEEMEEEAEMEIDRIL

Primary citation

Structural basis of CHMP2A-CHMP3 ESCRT-III polymer assembly and membrane cleavage. Azad, K., Guilligay, D., Boscheron, C. et al. Nat Struct Mol Biol (2023) 30:81-90. DOI 10.1038/s41594-022-00867-8 · PubMed

Other PDB entries of the same protein (UniProt O43633 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ZCG 3.3 Å, CHMP2A-CHMP3 heterodimer (430 Angstrom diameter)

Browse structure collections

About this viewer

MolViewer shows 7ZCH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.