7ZQY: Chaetomium thermophilum Rad50 Zn hook

Chaetomium thermophilum Rad50 Zn hook. Determined by X-ray diffraction at 2.51 Å resolution. Released 28 Dec 2022.

Method: X-ray diffraction
Resolution: 2.51 Å
Organism: Thermochaetoides thermophila
Chains: 4
Atoms: 5,801
Mol. weight: 83.67 kDa
Ligands: ZN
Released: 28 Dec 2022

Explore 7ZQY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ZQY contains 28 α-helices and 8 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	603-638	36
α-helix	644-646	3
α-helix	647-649	3
α-helix	650-688	39
β-strand	690	1	1
β-strand	697	1	1
α-helix	702-715	14
α-helix	719-740	22
α-helix	742-772	31

Chain B: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	601-638	38
α-helix	644-646	3
α-helix	647-649	3
α-helix	650-688	39
β-strand	690-691	2	2
β-strand	696-697	2	2
α-helix	702-714	13
α-helix	718-740	23
α-helix	742-775	34

Chain C: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	601-638	38
α-helix	644-646	3
α-helix	647-649	3
α-helix	650-688	39
β-strand	690	1	3
β-strand	697	1	3
α-helix	702-713	12
α-helix	719-740	22
α-helix	742-772	31

Chain D: 7 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	601-638	38
α-helix	644-646	3
α-helix	647-649	3
α-helix	650-688	39
β-strand	690	1	4
β-strand	697	1	4
α-helix	702-715	14
α-helix	719-740	22
α-helix	742-774	33

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DH domain-containing protein	A, B, C, D	protein	177	Thermochaetoides thermophila	G0SHW7 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>7ZQY_1 DH domain-containing protein (chains A, B, C, D)
QQELKQAEYQLSNARNLHNKLTNEMEACMRAVQTAMKEARDLDSAPPVDEYITMLETDEK
ELAEVETALKLYDELKKHYSTIKDRALRFNKCYICDRDFTNQEAAKTRLLEKVAKRLGDE
EKKELLEDQAAFMKSLDILRAVRVKYDTYQRLSSELPQLSREIDSETNRREDLVRRL

Ligands and cofactors

ID	Name	Formula	Copies
ZN	Zinc ion	Zn	2

Primary citation

Cryo-EM structure of the Mre11-Rad50-Nbs1 complex reveals the molecular mechanism of scaffolding functions. Rotheneder, M., Stakyte, K., van de Logt, E. et al. Mol Cell (2023) 83:167-185.e9. DOI 10.1016/j.molcel.2022.12.003 · PubMed

Other PDB entries of the same protein (UniProt G0SHW7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5DAC 2.5 Å, ATP-gamma-S bound Rad50 from Chaetomium thermophilum in complex with DNA
5DA9 3.0 Å, ATP-gamma-S bound Rad50 from Chaetomium thermophilum in complex with the Rad50-binding…
7ZR1 4.0 Å, Chaetomium thermophilum Mre11-Rad50-Nbs1 complex bound to ATPyS (composite structure)

Browse structure collections

About this viewer

MolViewer shows 7ZQY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.