8A5L: TRIM7 PRYSPRY

TRIM7 PRYSPRY in complex with a 2BC peptide TIEALFQ. Determined by X-ray diffraction at 1.62 Å resolution. Released 6 Jul 2022.

Method: X-ray diffraction
Resolution: 1.62 Å
Organisms: Homo sapiens, Enterovirus A71
Chains: 2
Atoms: 1,591
Mol. weight: 21.31 kDa
Ligands: TAR
Released: 6 Jul 2022

Explore 8A5L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8A5L contains 1 α-helix and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 16 β-strands

Element	Residues	Length	Sheet
β-strand	5	1	1
β-strand	14-16	3	2
β-strand	22-25	4	2
β-strand	44-46	3	3
β-strand	47	1	1
β-strand	51	1	3
β-strand	55-62	8	2
β-strand	68-74	7	3
α-helix	87-89	3
β-strand	91-97	7	3
β-strand	100-103	4	3
β-strand	110-112	3	3
β-strand	119-125	7	2
β-strand	130-135	6	2
β-strand	140-146	7	2
β-strand	153-159	7	3
β-strand	166-169	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase TRIM7	A	protein	179	Homo sapiens	Q9C029 (AlphaFold model)
2BC peptide TIEALFQ	B	protein	7	Enterovirus A71	B9VUU3

Sequence of entity 1 (A), FASTA

>8A5L_1 E3 ubiquitin-protein ligase TRIM7 (chains A)
MAHHHHHHMVELTLDPDTANPRLILSLDLKGVRLGERAQDLPNHPCRFDTNTRVLASCGF
SSGRHHWEVEVGSKDGWAFGVARESVRRKGLTPFTPEEGVWALQLNGGQYWAVTSPERSP
LSCGHLSRVRVALDLEVGAVSFYAVEDMRHLYTFRVNFQERVFPLFSVCSTGTYLRIWP

Sequence of entity 2 (B), FASTA

>8A5L_2 2BC peptide TIEALFQ (chains B)
TIEALFQ

Ligands and cofactors

ID	Name	Formula	Copies
TAR	D(-)-tartaric acid	C4 H6 O6	1

Primary citation

TRIM7 Restricts Coxsackievirus and Norovirus Infection by Detecting the C-Terminal Glutamine Generated by 3C Protease Processing. Luptak, J., Mallery, D.L., Jahun, A.S. et al. Viruses (2022) 14. DOI 10.3390/v14081610 · PubMed

Other PDB entries of the same protein (UniProt Q9C029 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7W0Q 1.1 Å, TRIM7 in complex with C-terminal peptide of 2C
7X70 1.25 Å, TRIM7 in complex with C-terminal peptide of NSP8
7X6Y 1.39 Å, TRIM7 in complex with C-terminal peptide of NSP5
7W0S 1.4 Å, TRIM7 in complex with C-terminal peptide of 2C
7X6Z 1.43 Å, TRIM7 in complex with C-terminal peptide of NSP12
9HIN 1.55 Å, Crystal structure of human TRIM7 PRYSPRY domain bound to…
7W0T 1.57 Å, TRIM7 in complex with C-terminal peptide of 2C
6UMA 1.6 Å, Crystal structure of the TRIM7 B30.2 domain at 1.6 angstrom resolution
8R5B 1.6 Å, Crystal structure of human TRIM7 PRYSPRY domain bound to (3-phenoxybenzoyl)-L-glutamine
8R5C 1.6 Å, Crystal structure of human TRIM7 PRYSPRY domain bound to…
7OVX 1.7 Å, E3 RING ligase binding domain
7Y3A 1.7 Å, Crystal structure of TRIM7 bound to 2C

Browse structure collections

About this viewer

MolViewer shows 8A5L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.