10 picosecond light activated crystal structure of bovine rhodopsin in Lipidic Cubic Phase. Determined by X-ray diffraction at 1.8 Å resolution. Released 29 Mar 2023.
Explore 8A6D in 3D Show helices and sheets RCSB PDB PDBe
8A6D contains 32 α-helices and 8 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-6 | 3 | 1 |
| β-strand | 9-11 | 3 | 1 |
| α-helix | 34-64 | 31 | |
| α-helix | 71-85 | 15 | |
| α-helix | 86-91 | 6 | |
| α-helix | 92-100 | 9 | |
| α-helix | 106-140 | 35 | |
| α-helix | 150-168 | 19 | |
| α-helix | 170-172 | 3 | |
| β-strand | 178-181 | 4 | 2 |
| β-strand | 186-189 | 4 | 2 |
| α-helix | 196-198 | 3 | |
| α-helix | 200-208 | 9 | |
| α-helix | 209-213 | 5 | |
| α-helix | 214-227 | 14 | |
| α-helix | 246-277 | 32 | |
| α-helix | 285-294 | 10 | |
| α-helix | 295-299 | 5 | |
| α-helix | 301-309 | 9 | |
| α-helix | 311-321 | 11 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-5 | 2 | 3 |
| β-strand | 10-11 | 2 | 3 |
| α-helix | 34-64 | 31 | |
| α-helix | 71-85 | 15 | |
| α-helix | 86-91 | 6 | |
| α-helix | 92-100 | 9 | |
| α-helix | 106-140 | 35 | |
| α-helix | 150-168 | 19 | |
| α-helix | 170-172 | 3 | |
| β-strand | 178-181 | 4 | 4 |
| β-strand | 186-189 | 4 | 4 |
| α-helix | 196-198 | 3 | |
| α-helix | 200-208 | 9 | |
| α-helix | 209-213 | 5 | |
| α-helix | 214-227 | 14 | |
| α-helix | 245-276 | 32 | |
| α-helix | 285-294 | 10 | |
| α-helix | 295-299 | 5 | |
| α-helix | 301-309 | 9 | |
| α-helix | 311-321 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Rhodopsin | A, B | protein | 348 | Bos taurus | P02699 (AlphaFold model) |
>8A6D_1 Rhodopsin (chains A, B) MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLY VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLG GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIP EGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQES ATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAV YNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA
| ID | Name | Formula | Copies |
|---|---|---|---|
| ACE | Acetyl group | C2 H4 O | 2 |
| RET | Retinal | C20 H28 O | 2 |
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 2 |
| OLC | (2R)-2,3-dihydroxypropyl (9Z)-octadec-9-enoate | C21 H40 O4 | 13 |
| PLM | Palmitic acid | C16 H32 O2 | 2 |
| DAO | Lauric acid | C12 H24 O2 | 1 |
Ultrafast structural changes direct the first molecular events of vision. Gruhl, T., Weinert, T., Rodrigues, M.J. et al. Nature (2023) 615:939-944. DOI 10.1038/s41586-023-05863-6 · PubMed
Other PDB entries of the same protein (UniProt P02699 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8A6D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.