Structure of self-assembling engineered protein nanocage (EPN) fused with hepatitis A pX protein. Determined by electron microscopy at 6.7 Å resolution. Released 10 Aug 2022.
Explore 8A8N in 3D Show helices and sheets RCSB PDB PDBe
8A8N contains 12 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1-8 | 8 | |
| β-strand | 10-14 | 5 | 1 |
| α-helix | 19-31 | 13 | |
| β-strand | 36-40 | 5 | 1 |
| α-helix | 46-53 | 8 | |
| α-helix | 54-59 | 6 | |
| β-strand | 62-66 | 5 | 1 |
| α-helix | 71-79 | 9 | |
| β-strand | 84-86 | 3 | 1 |
| α-helix | 92-101 | 10 | |
| β-strand | 104-106 | 3 | 1 |
| β-strand | 108-109 | 2 | 2 |
| α-helix | 112-120 | 9 | |
| β-strand | 125-128 | 4 | 2 |
| α-helix | 131-134 | 4 | |
| α-helix | 136-143 | 8 | |
| β-strand | 150-153 | 4 | 2 |
| β-strand | 154 | 1 | 1 |
| α-helix | 162-168 | 7 | |
| β-strand | 173-175 | 3 | 1 |
| α-helix | 177-180 | 4 | |
| α-helix | 184-199 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| EPN-pX | A | protein | 302 | Human immunodeficiency virus type 1 BH10 | A0A0F7Q1W1, Q9WXS1 (AlphaFold model) |
>8A8N_1 EPN-pX (chains A) MGARASGSKSGSGSDSGSKIEELFKKHKIVAVLRANSVEEAKKKALAVFLGGVHLIEITF TVPDADTVIKELSFLKEMGAIIGAGTVTSVEQCRKAVESGAEFIVSPHLDEEISQFCKEK GVFYMPGVMTPTELVKAMKLGHTILKLFPGEVVGPQFVKAMKGPFPNVKFVPTGGVNLDN VCEWFKAGVLAVGVGSALVKGTPVEVAEKAKAFVEKIRGCTEQKLISEEDLMMSRIAAGD LESSVDDPRSEEDKRFESHIECRKPYKELRLEVGKQRLKYAQEELSNEVLPPPRKMKGLF SQ
Nonlytic cellular release of hepatitis A virus requires dual capsid recruitment of the ESCRT-associated Bro1 domain proteins HD-PTP and ALIX. Shirasaki, T., Feng, H., Duyvesteyn, H.M.E. et al. PLoS Pathog (2022) 18:e1010543-e1010543. DOI 10.1371/journal.ppat.1010543 · PubMed
MolViewer shows 8A8N directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.