8A8Q: Protein Scalloped

Name: PDB 8A8Q: Crystal structure of Protein Scalloped in complex with YAP peptide
Published: 2022-12-28
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal structure of Protein Scalloped in complex with YAP peptide. Determined by X-ray diffraction at 1.47 Å resolution. Released 28 Dec 2022.

Method: X-ray diffraction
Resolution: 1.47 Å
Organisms: Drosophila melanogaster, Homo sapiens
Chains: 4
Atoms: 4,211
Mol. weight: 62.63 kDa
Released: 28 Dec 2022

Explore 8A8Q in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8A8Q contains 25 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	226	1	1
β-strand	230-243	14	1
β-strand	246-255	10	1
α-helix	263-266	4
β-strand	267-270	4	2
α-helix	271-273	3
α-helix	275-277	3
α-helix	285-291	7
α-helix	294-296	3
β-strand	297-304	8	2
β-strand	319-328	10	1
β-strand	334-342	9	2
β-strand	345-354	10	2
β-strand	357-359	3	1
β-strand	362-371	10	1
α-helix	372-373	2
α-helix	374-384	11
α-helix	389-396	8
β-strand	399-407	9	2
β-strand	413-423	11	2
α-helix	424-425	2
β-strand	431-438	8	2

Chain B: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	226	1	3
β-strand	230-243	14	3
β-strand	246-255	10	3
β-strand	267-270	4	2
α-helix	271-273	3
α-helix	275-277	3
α-helix	285-291	7
α-helix	294-296	3
β-strand	297-304	8	2
β-strand	319-328	10	3
β-strand	334-342	9	2
β-strand	345-354	10	2
β-strand	357-359	3	3
β-strand	362-371	10	3
α-helix	372-373	2
α-helix	374-384	11
α-helix	389-396	8
β-strand	399-407	9	2
β-strand	413-423	11	2
α-helix	424-425	2
β-strand	431-438	8	2

Chains C and D: 4 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	52-57	6	2
α-helix	61-73	13
α-helix	83-85	3
α-helix	86-88	3
α-helix	93-96	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein scalloped	A, B	protein	219	Drosophila melanogaster	P30052 (AlphaFold model)
Isoform 7 of Transcriptional coactivator YAP1	C, D	protein	51	Homo sapiens	P46937 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8A8Q_1 Protein scalloped (chains A, B)
GRAIATHKFRLLEFTAFMEIQRDEIYHRHLFVQLGGKPSFSDPLLETVDIRQIFDKFPEK
SGGLKDLYEKGPQNAFYLVKCWADLNTDLTTGSETGDFYGVTSQYESNENVVLVCSTIVC
SFGKQVVEXVESEYSRLENNRYVYRIQRSPMCEYMINFIQKLKNLPERYMMNSVLENFTI
LQVMRARETQETLLCIAYVFEVAAQNSGTTHHIYRLIKE

Sequence of entity 2 (C, D), FASTA

>8A8Q_2 Isoform 7 of Transcriptional coactivator YAP1 (chains C, D)
XGHQIVHVRGDSETDLEALFNAVLNPKTANVPQTVPLRLRKLPDSFFKPPX

Primary citation

N-terminal beta-strand in YAP is critical for stronger binding to scalloped relative to TEAD transcription factor. Fedir, B., Yannick, M., Marco, M. et al. Protein Sci (2023) 32:e4545-e4545. DOI 10.1002/pro.4545 · PubMed

Other PDB entries of the same protein (UniProt P30052 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6Y20 1.85 Å, Crystal structure of Protein Scalloped (222-440) bound to Protein Vestigial (298-337)

Browse structure collections

About this viewer

MolViewer shows 8A8Q directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.