8A8R: TEAD4

Name: PDB 8A8R: Crystal structure of TEAD4 in complex with YAP peptide
Published: 2022-12-28
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Crystal structure of TEAD4 in complex with YAP peptide. Determined by X-ray diffraction at 1.7 Å resolution. Released 28 Dec 2022.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 4
Atoms: 4,271
Mol. weight: 62.92 kDa
Ligands: MYR
Released: 28 Dec 2022

Explore 8A8R in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8A8R contains 21 α-helices and 28 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	220	1	1
β-strand	225-238	14	1
β-strand	241-250	10	1
β-strand	264-266	3	2
α-helix	267-269	3
α-helix	271-273	3
α-helix	281-287	7
α-helix	290-292	3
β-strand	293-300	8	2
β-strand	311-322	12	1
β-strand	328-336	9	2
β-strand	339-348	10	2
β-strand	351-353	3	1
β-strand	356-365	10	1
α-helix	366-367	2
α-helix	368-378	11
α-helix	383-390	8
β-strand	393-401	9	2
β-strand	407-417	11	2
β-strand	425-432	8	2

Chain B: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	220	1	1
β-strand	225-238	14	1
β-strand	241-250	10	1
α-helix	259-261	3
β-strand	264-266	3	3
α-helix	267-269	3
α-helix	271-273	3
α-helix	281-287	7
α-helix	290-292	3
β-strand	293-300	8	3
β-strand	312-322	11	1
β-strand	328-336	9	3
β-strand	339-348	10	3
β-strand	351-353	3	1
β-strand	356-365	10	1
α-helix	366-367	2
α-helix	368-378	11
α-helix	383-390	8
β-strand	393-401	9	3
β-strand	407-417	11	3
β-strand	425-432	8	3

Chain L: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	54-57	4	2
α-helix	61-73	13
α-helix	86-88	3
α-helix	93-95	3

Chain M: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	54-57	4	3
α-helix	61-70	10
α-helix	86-88	3
α-helix	93-96	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcriptional enhancer factor TEF-3	A, B	protein	219	Homo sapiens	Q15561 (AlphaFold model)
Isoform 7 of Transcriptional coactivator YAP1	L, M	protein	53	Homo sapiens	P46937 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8A8R_1 Transcriptional enhancer factor TEF-3 (chains A, B)
GRSVASSKLWMLEFSAFLEQQQDPDTYNKHLFVHIGQSSPSYSDPYLEAVDIRQIYDKFP
EKKGGLKDLFERGPSNAFFLVKFWADLNTNIEDEGSSFYGVSSQYESPENMIITCSTKVC
SFGKQVVEKVETEYARYENGHYSYRIHRSPLCEYMINFIHKLKHLPEKYMMNSVLENFTI
LQVVTNRDTQETLLCIAYVFEVSASEHGAQHHIYRLVKE

Sequence of entity 2 (L, M), FASTA

>8A8R_2 Isoform 7 of Transcriptional coactivator YAP1 (chains L, M)
XAGHQIVHVRGDSETDLEALFNAVMNPKTANVPQTVPMRLRKLPDSFFKPPEX

Ligands and cofactors

ID	Name	Formula	Copies
MYR	Myristic acid	C14 H28 O2	2

Primary citation

N-terminal beta-strand in YAP is critical for stronger binding to scalloped relative to TEAD transcription factor. Fedir, B., Yannick, M., Marco, M. et al. Protein Sci (2023) 32:e4545-e4545. DOI 10.1002/pro.4545 · PubMed

Other PDB entries of the same protein (UniProt Q15561 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9SYN 1.3 Å, Crystal structure of TEAD4 in complex with Vgll1-peptide and IAG933
6GEI 1.65 Å, TEAD4 (216-434);E263A+Y429F complexed with yap peptide (60- 100);S94A and myristoate…
6HIK 1.65 Å, X-ray structure of TEAD4(Y429H) mutant) complexed with YAP (wildtype): Molecular and…
6SEN 1.65 Å, TEAD4 bound to a FAM181A peptide
6GEC 1.7 Å, TEAD4 (216-434) complexed with yap peptide (60-100);S94A and myristoate (covalently…
9QKQ 1.74 Å, Crystal structure of hTEAD4 YAP binding domain (hTEAD4-YBD) in complex with peptide 6
6GE6 1.8 Å, X-ray structure of TEAD4(E263A+Y429F mutant) complexed with YAP(wildtype): The role of…
6GE3 1.85 Å, X-ray structure of TEAD4 (wildtype) complexed with YAP (wildtype): The role of residual…
5OAQ 1.95 Å, TEAD4 complexed with yap peptide and myristate (covalently bound)
6GEE 1.96 Å, TEAD4 (216-434);E263A complexed with yap peptide (60-100); S94A and myristoate…
6GE4 1.97 Å, TEAD4 (216-434);E263A complexed with yap peptide (60-100) and myristoate (covalently…
8CAA 2.0 Å, Crystal structure of TEAD4 in complex with YTP-13

Browse structure collections

About this viewer

MolViewer shows 8A8R directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.