8AG3: Vaccinia C16 N-terminal domains

Vaccinia C16 N-terminal domains. Determined by electron microscopy at 3.47 Å resolution. Released 9 Nov 2022.

Method: Electron microscopy
Resolution: 3.47 Å
Organism: Vaccinia virus Western Reserve
Chains: 2
Atoms: 2,632
Mol. weight: 84.95 kDa
Released: 9 Nov 2022

Explore 8AG3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8AG3 contains 5 α-helices and 27 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 3 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	1
β-strand	10-14	5	1
α-helix	21-30	10
β-strand	38-42	5	1
α-helix	48-59	12
β-strand	64-69	6	1
β-strand	72-78	7	1
β-strand	85-86	2	2
β-strand	98-108	11	1
β-strand	113	1	3
β-strand	116-119	4	2
β-strand	124-127	4	2
β-strand	131-134	4	1
β-strand	138-141	4	2
α-helix	142-143	2
β-strand	144	1	3
β-strand	149-160	12	1

Chain D: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	1
β-strand	10-15	6	1
α-helix	23-30	8
β-strand	38-41	4	1
α-helix	47-60	14
β-strand	64-69	6	1
β-strand	73-78	6	1
β-strand	98-108	11	1
β-strand	112-113	2	4
β-strand	116-118	3	2
β-strand	124-127	4	2
β-strand	130-134	5	1
β-strand	139-141	3	2
β-strand	144-146	3	4
β-strand	149-160	12	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein C10	C, D	protein	369	Vaccinia virus Western Reserve	P03296 (AlphaFold model)

Sequence of entity 1 (C, D), FASTA

>8AG3_1 Protein C10 (chains C, D)
MDIYDDKGLQTIKLFNNEFDCIRNDIRELFKHVTDSDSIQLPMEDNSDIIENIRKILYRR
LKNVECVDIDSTITFMKYDPNDDNKRTCSNWVPLTNNYMEYCLVIYLETPICGGKIKLYH
PTGNIKSDKDIMFAKTLDFKSKKVLTGRKTIAVLDISVSYNRSMTTIHYNDDVDIDIHTD
KNGKELCYCYITIDDHYLVDVETIGVIVNRSGKCLLVNNHLGIGIVKDKRISDSFGDVCM
DTIFDFSEARELFSLTNDDNRNIAWDTDKLDDDTDIWTPVTEDDYKFLSRLVLYAKSQSD
TVFDYYVLTGDTEPPTVFIFKVTRFYFNMPKGGENLYFQGWSHPQFEKGGGSGGGSGGSS
AWSHPQFEK

Primary citation

Structural basis for the inactivation of cytosolic DNA sensing by the vaccinia virus. Rivera-Calzada, A., Arribas-Bosacoma, R., Ruiz-Ramos, A. et al. Nat Commun (2022) 13:7062-7062. DOI 10.1038/s41467-022-34843-z · PubMed

Other PDB entries of the same protein (UniProt P03296 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8AG4 2.46 Å, Vaccinia C16 protein bound to Ku70/Ku80
8AG5 3.47 Å, Vaccinia C16 protein bound to Ku70/Ku80

Browse structure collections

About this viewer

MolViewer shows 8AG3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.