8AIM: Ugi-2 SAUNG complex

Ugi-2 SAUNG complex. Determined by X-ray diffraction at 2.6 Å resolution. Released 21 Jun 2023.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Bacillus phage vB_BpuM-BpSp, Staphylococcus aureus
Chains: 4
Atoms: 4,951
Mol. weight: 73 kDa
Released: 21 Jun 2023

Explore 8AIM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8AIM contains 30 α-helices and 22 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	3-13	11
α-helix	17-29	13
β-strand	32-33	2	3
α-helix	36-38	3
α-helix	41-45	5
α-helix	48-50	3
β-strand	53-57	5	4
α-helix	82-94	13
α-helix	105-110	6
β-strand	112-116	5	4
β-strand	121-122	2	3
α-helix	134-148	15
β-strand	153-157	5	4
α-helix	159-162	4
α-helix	163-167	5
β-strand	174-178	5	4
α-helix	186-188	3
α-helix	195-205	11
α-helix	208-211	4

Chain B: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	5-16	12
β-strand	24-28	5	1
α-helix	30-37	8
β-strand	45-51	7	1
β-strand	57-62	6	1
β-strand	70-76	7	1
β-strand	81-86	6	1

Chain E: 13 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	3-11	9
α-helix	17-29	13
β-strand	32-33	2	5
α-helix	36-38	3
α-helix	41-45	5
α-helix	48-50	3
β-strand	53-57	5	6
α-helix	82-94	13
α-helix	105-110	6
β-strand	112-116	5	6
β-strand	121-122	2	5
α-helix	134-148	15
β-strand	153-157	5	6
α-helix	159-162	4
α-helix	163-167	5
β-strand	174-178	5	6
α-helix	186-188	3
α-helix	195-205	11
α-helix	208-211	4

Chain G: 2 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	5-16	12
β-strand	24-28	5	2
α-helix	30-37	8
β-strand	45-51	7	2
β-strand	57-62	6	2
β-strand	70-76	7	2
β-strand	81-85	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Uracil-DNA glycosylase inhibitor	B, G	protein	89	Bacillus phage vB_BpuM-BpSp	A0A141HSF0 (AlphaFold model)
Uracil-DNA glycosylase	A, E	protein	226	Staphylococcus aureus	Q6GJ88 (AlphaFold model)

Sequence of entity 1 (B, G), FASTA

>8AIM_1 Uracil-DNA glycosylase inhibitor (chains B, G)
MYKNIEDLNKFASKILETEISFEESITFTPDEVEENIGEKPNRDKICHSTSLEDGRVIML
LTELEPNYTPWKLLELEEDGFKELYSKSI

Sequence of entity 2 (A, E), FASTA

>8AIM_2 Uracil-DNA glycosylase (chains A, E)
MEWSQIFHDITTKHDFKAMHDFLEKEYSTAIVYPDRENIYQAFDLTPFENIKVVILGQDP
YHGPNQAHGLAFSVQPNAKFPPSLRNMYKELADDIGCVRQTPHLQDWAREGVLLLNTVLT
VRQGEANSHRDIGWETFTDEIIKAVSDYKEHVVFILWGKPAQQKIKLIDTSKHCIIKSVH
PSPLSAYRGFFGSKPYSKANTYLESVGKSPINWCESEALEHHHHHH

Primary citation

A Multimodal Approach towards Genomic Identification of Protein Inhibitors of Uracil-DNA Glycosylase. Muselmani, W., Kashif-Khan, N., Bagneris, C. et al. Viruses (2023) 15. DOI 10.3390/v15061348 · PubMed

Browse structure collections

About this viewer

MolViewer shows 8AIM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.