8ALX: Human PD-L1

Structure of human PD-L1 in complex with inhibitor. Determined by X-ray diffraction at 1.1 Å resolution. Released 16 Aug 2023.

Method: X-ray diffraction
Resolution: 1.1 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 1,460
Mol. weight: 16.94 kDa
Released: 16 Aug 2023

Explore 8ALX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ALX contains 5 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	1
β-strand	27-31	5	2
β-strand	36-41	6	1
α-helix	50-52	3
β-strand	54-59	6	2
β-strand	62-68	7	2
β-strand	71	1	2
α-helix	74-76	3
α-helix	79-81	3
β-strand	85-87	3	1
α-helix	89-93	5
β-strand	96-101	6	1
α-helix	106-108	3
β-strand	110-117	8	2
β-strand	121-131	11	2

Chain B: 0 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	8-9	2	3
β-strand	13-14	2	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Programmed cell death 1 ligand 1	A	protein	128	Homo sapiens	Q9NZQ7 (AlphaFold model)
3-pyridin-4-yl-2,4-dihydro-INDENO[1,2-.c.]pyrazole, aminomethylamide	B	protein	16	synthetic construct

Sequence of entity 1 (A), FASTA

>8ALX_1 Programmed cell death 1 ligand 1 (chains A)
AFTVTVPKDLYVVEYGSNMTIECKFPVEKQLDLAALIVYWEMEDKNIIQFVHGEEDLKVQ
HSSYRQRARLLKDQLSLGNAALQITDVKLQDAGVYRCMISYGGADYKRITVKVNAPYAAA
LEHHHHHH

Sequence of entity 2 (B), FASTA

>8ALX_2 3-PYRIDIN-4-YL-2,4-DIHYDRO-INDENO[1,2-.C.]PYRAZOLE, AMINOMETHYLAMIDE (chains B)
YANPALPWAWXXLCGX

Primary citation

Structural and biological characterization of pAC65, a macrocyclic peptide that blocks PD-L1 with equivalent potency to the FDA-approved antibodies. Rodriguez, I., Kocik-Krol, J., Skalniak, L. et al. Mol Cancer (2023) 22:150-150. DOI 10.1186/s12943-023-01853-4 · PubMed

Other PDB entries of the same protein (UniProt Q9NZQ7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5O45 0.99 Å, Structure of human PD-L1 in complex with inhibitor
6NP9 1.27 Å, PD-L1 IgV domain V76T with fragment
9I0U 1.46 Å, Structure of human PD-L1 in complex with clinically evaluated inhibitor
6YCR 1.54 Å, Structure of human PD-L1 in complex with inhibitor
8AOK 1.6 Å, Complex of PD-L1 with VHH6
13DT 1.64 Å, Structure of FabS1CE2_P4a in complex with the N-terminal domain of PD-L1
7CZD 1.64 Å, Crystal structure of PD-L1 in complex with a VHH
5JDS 1.7 Å, Crystal structure of PD-L1 complexed with a nanobody at 1.7 Angstron resolution
5N2F 1.7 Å, Structure of PD-L1/small-molecule inhibitor complex
9QSM 1.75 Å, small molecule inhibitor in complex with PD-L1
8ZNL 1.77 Å, PD-L1 de novo designed binder with picomolar binding affinity
5C3T 1.8 Å, PD-1 binding domain from human PD-L1

Browse structure collections

About this viewer

MolViewer shows 8ALX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.