Specific covalent inhibitor (6) of ERK2. Determined by X-ray diffraction at 1.59 Å resolution. Released 28 Sept 2022.
Explore 8AO5 in 3D Show helices and sheets RCSB PDB PDBe
8AO5 contains 23 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 25-32 | 8 | 1 |
| β-strand | 39-44 | 6 | 1 |
| β-strand | 49-56 | 8 | 1 |
| α-helix | 62-77 | 16 | |
| β-strand | 83 | 1 | 2 |
| β-strand | 88-90 | 3 | 1 |
| β-strand | 101-106 | 6 | 1 |
| β-strand | 110-111 | 2 | 2 |
| α-helix | 112-118 | 7 | |
| α-helix | 120-122 | 3 | |
| α-helix | 123-142 | 20 | |
| β-strand | 145-146 | 2 | 3 |
| α-helix | 152-154 | 3 | |
| β-strand | 155-157 | 3 | 2 |
| β-strand | 163-165 | 3 | 2 |
| β-strand | 172-173 | 2 | 3 |
| α-helix | 176-178 | 3 | |
| β-strand | 180 | 1 | 4 |
| α-helix | 191-193 | 3 | |
| α-helix | 196-199 | 4 | |
| β-strand | 202 | 1 | 4 |
| α-helix | 208-223 | 16 | |
| α-helix | 233-244 | 12 | |
| α-helix | 247-248 | 2 | |
| α-helix | 249-253 | 5 | |
| α-helix | 258-266 | 9 | |
| α-helix | 268-269 | 2 | |
| α-helix | 271-274 | 4 | |
| α-helix | 275-278 | 4 | |
| α-helix | 284-293 | 10 | |
| α-helix | 302-303 | 2 | |
| α-helix | 304-308 | 5 | |
| α-helix | 311-313 | 3 | |
| α-helix | 319-321 | 3 | |
| α-helix | 340-351 | 12 | |
| α-helix | 352-354 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Mitogen-activated protein kinase 1 | A | protein | 368 | Homo sapiens | P28482 (AlphaFold model) |
>8AO5_1 Mitogen-activated protein kinase 1 (chains A) MAHHHHHHMAAAAAAGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVA IKKISPFEHQTYCQRTLREIKILLRFRHENIIGINDIIRAPTIEQMKDVYIVQDLMETDL YKLLKTQHLSNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLAR VADPDHDHTGFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKH YLDQLNHILGILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADSKALDLLDK MLTFNPHKRIEVEQALAHPYLEQYYDPSDEPIAEAPFKFDMELDDLPKEKLKELIFEETA RFQPGYRS
| ID | Name | Formula | Copies |
|---|---|---|---|
| N6K | ~{N}-(1~{H}-indazol-5-ylmethyl)ethanesulfonamide | C10 H13 N3 O2 S | 1 |
Water and common crystallization additives (EPE, SO4) are not listed.
X-ray Screening of an Electrophilic Fragment Library and Application toward the Development of a Novel ERK 1/2 Covalent Inhibitor. St Denis, J.D., Chessari, G., Cleasby, A. et al. J Med Chem (2022) 65:12319-12333. DOI 10.1021/acs.jmedchem.2c01044 · PubMed
Other PDB entries of the same protein (UniProt P28482 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8AO5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.