The SH2 domain of mouse SH2B1. Determined by solution NMR. Released 24 May 2023.
Explore 8ATK in 3D Show helices and sheets RCSB PDB PDBe
8ATK contains 6 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 19 | 1 | 1 |
| α-helix | 24-31 | 8 | |
| α-helix | 36-38 | 3 | |
| β-strand | 41-45 | 5 | 1 |
| β-strand | 53-60 | 8 | 1 |
| β-strand | 63-71 | 9 | 1 |
| β-strand | 77-79 | 3 | 1 |
| β-strand | 82-84 | 3 | 1 |
| α-helix | 87-96 | 10 | |
| α-helix | 98-99 | 2 | |
| β-strand | 100 | 1 | 2 |
| α-helix | 101 | 1 | |
| β-strand | 106 | 1 | 2 |
| β-strand | 113-114 | 2 | 1 |
| α-helix | 115-117 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| SH2B adapter protein 1 | A | protein | 118 | Mus musculus | Q91ZM2 (AlphaFold model) |
>8ATK_1 SH2B adapter protein 1 (chains A) KIHHHHHHDQPLSGYPWFHGMLSRLKAAQLVLEGGTGSHGVFLVRQSETRRGEYVLTFNF QGKAKHLRLSLNEEGQCRVQHLWFQSIFDMLEHFRVHPIPLESGGSSDVVLVSYVPSQ
Improved methodology for protein NMR structure calculation using hydrogen bond restraints and ANSURR validation: The SH2 domain of SH2B1. Fowler, N.J., Albalwi, M.F., Lee, S. et al. Structure (2023) 31:975. DOI 10.1016/j.str.2023.05.012 · PubMed
Other PDB entries of the same protein (UniProt Q91ZM2 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8ATK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.