8BBJ: Secretagogin

Secretagogin (mouse) in complex with its target peptide from Syntaxin-4. Determined by X-ray diffraction at 2.65 Å resolution. Released 3 Apr 2024.

Method: X-ray diffraction
Resolution: 2.65 Å
Organisms: Aequorea victoria, Mus musculus
Chains: 4
Atoms: 6,925
Mol. weight: 103.32 kDa
Ligands: CA, CAC
Released: 3 Apr 2024

Explore 8BBJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8BBJ contains 35 α-helices and 38 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	3-6	4
β-strand	11-22	12	1
β-strand	25-36	12	1
β-strand	41-48	8	1
α-helix	57-60	4
α-helix	69-71	3
β-strand	73	1	1
α-helix	76-81	6
β-strand	92-100	9	1
β-strand	105-115	11	1
β-strand	118-128	11	1
β-strand	141	1	2
β-strand	148-155	8	1
β-strand	160-170	11	1
β-strand	171	1	2
β-strand	176-187	12	1
α-helix	194-197	4
β-strand	199-208	10	1
β-strand	217-227	11	1
α-helix	236-253	18

Chain B: 8 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
β-strand	11-22	12	3
β-strand	25-36	12	3
β-strand	41-48	8	3
α-helix	57-60	4
α-helix	69-71	3
β-strand	73	1	3
α-helix	74-75	2
α-helix	76-81	6
α-helix	83-87	5
β-strand	92-100	9	3
β-strand	105-115	11	3
β-strand	118-128	11	3
β-strand	141	1	4
β-strand	148-155	8	3
β-strand	160-170	11	3
β-strand	171	1	4
β-strand	176-187	12	3
α-helix	195-197	3
β-strand	199-208	10	3
β-strand	217-227	11	3
α-helix	236-254	19

Chain C: 11 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	96-100	5
α-helix	102-103	2
β-strand	104	1	5
α-helix	107-117	11
β-strand	125	1	6
α-helix	127-140	14
α-helix	147-161	15
β-strand	169	1	6
α-helix	171-177	7
β-strand	180	1	5
α-helix	184-187	4
α-helix	195-209	15
β-strand	216-217	2	7
α-helix	220-230	11
α-helix	241-253	13
β-strand	261-262	2	7
α-helix	263-269	7

Chain D: 10 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	102-104	3
α-helix	107-117	11
β-strand	125	1	8
α-helix	127-141	15
α-helix	147-161	15
β-strand	169	1	8
α-helix	171-177	7
α-helix	184-187	4
α-helix	195-209	15
β-strand	216-217	2	9
α-helix	220-233	14
α-helix	239-253	15
β-strand	261-262	2	9
α-helix	263-269	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Green fluorescent protein,Syntaxin-4	A, B	protein	259	Aequorea victoria, Mus musculus	P42212 (AlphaFold model), P70452 (AlphaFold model)
Secretagogin	C, D	protein	190	Mus musculus	Q91WD9 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8BBJ_1 Green fluorescent protein,Syntaxin-4 (chains A, B)
SMASKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWP
TLVTTLXVQCFSRYPDHMKRHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLV
NRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKTRHNIEDGSVQLAD
HYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGTMAGLQNLREEI
KQLGREVRAQLKAIEPQKE

Sequence of entity 2 (C, D), FASTA

>8BBJ_2 Secretagogin (chains C, D)
SMAEDENFLLFFRLETPLDNSVEFMQIWRKYDADSSGFISAAELCNFLRDLFLHHKKNIS
EAELEEYTSTMMKIFDKNKDGRLDLNDLARILALQENFLLQFKMDASSTEERKRDFEKIF
AHYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSEL
ALCLGLKINP

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	8
CAC	Cacodylate ion	C2 H6 As O2	1

Primary citation

A hydrophobic groove in secretagogin allows for alternate interactions with SNAP-25 and syntaxin-4 in endocrine tissues. Szodorai, E., Hevesi, Z., Wagner, L. et al. Proc Natl Acad Sci U S A (2024) 121:e2309211121-e2309211121. DOI 10.1073/pnas.2309211121 · PubMed

Other PDB entries of the same protein (UniProt P42212 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6L27 0.77 Å, X-ray crystal structure of the mutant green fluorescent protein
6JGJ 0.78 Å, Crystal structure of the F99S/M153T/V163A/E222Q variant of GFP at 0.78 A
6KL0 0.8 Å, Crystal structure of the S65T/F99S/M153T/V163A variant of perdeuterated GFP at pD 7.0
6JGI 0.85 Å, Crystal structure of the S65T/F99S/M153T/V163A variant of GFP at 0.85 A
6KL1 0.85 Å, Crystal structure of the S65T/F99S/M153T/V163A variant of non-deuterated GFP at pD 8.5
2WUR 0.9 Å, Atomic resolution structure of GFP measured on a rotating anode
6KKZ 0.9 Å, Crystal structure of the S65T/F99S/M153T/V163A variant of perdeuterated GFP at pD 8.5
6JGH 0.94 Å, Crystal structure of the F99S/M153T/V163A/T203I variant of GFP at 0.94 A
4AS8 1.02 Å, X-ray structure of the cyan fluorescent protein Cerulean cryoprotected with ethylene…
5OXC 1.02 Å, Structure of Cerulean Fluorescent Protein at 1.02 Angstrom resolution
7PCA 1.05 Å, Functional and structural characterization of redox sensitive superfolder green…
4GF6 1.1 Å, crystal structure of GFP with cuprum bound at the Incorporated metal Chelating Amino…

Browse structure collections

About this viewer

MolViewer shows 8BBJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.