GABA-A receptor a5 homomer - a5V1 - Flumazenil. Determined by X-ray diffraction at 2.56 Å resolution. Released 8 Nov 2023.
Explore 8BGI in 3D Show helices and sheets RCSB PDB PDBe
8BGI contains 55 α-helices and 65 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 16-26 | 11 | |
| α-helix | 34 | 1 | |
| β-strand | 42-57 | 16 | 1 |
| β-strand | 62-74 | 13 | 1 |
| α-helix | 76-78 | 3 | |
| β-strand | 86-89 | 4 | 1 |
| α-helix | 91-94 | 4 | |
| β-strand | 102-104 | 3 | 2 |
| β-strand | 107-112 | 6 | 1 |
| β-strand | 120-125 | 6 | 1 |
| β-strand | 129-141 | 13 | 1 |
| β-strand | 153-156 | 4 | 2 |
| β-strand | 159-162 | 4 | 2 |
| β-strand | 170-174 | 5 | 1 |
| β-strand | 182-184 | 3 | 1 |
| β-strand | 194-209 | 16 | 2 |
| β-strand | 211-224 | 14 | 2 |
| α-helix | 227-229 | 3 | |
| α-helix | 230-234 | 5 | |
| α-helix | 235-244 | 10 | |
| α-helix | 247-249 | 3 | |
| α-helix | 255-278 | 24 | |
| α-helix | 288-314 | 27 | |
| α-helix | 318-417 | 30 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 16-26 | 11 | |
| α-helix | 34 | 1 | |
| β-strand | 42-57 | 16 | 3 |
| β-strand | 62-74 | 13 | 3 |
| α-helix | 76-78 | 3 | |
| β-strand | 86-89 | 4 | 3 |
| α-helix | 91-94 | 4 | |
| β-strand | 102-104 | 3 | 4 |
| β-strand | 107-112 | 6 | 3 |
| β-strand | 120-125 | 6 | 3 |
| β-strand | 129-141 | 13 | 3 |
| β-strand | 153-162 | 10 | 4 |
| β-strand | 170-174 | 5 | 3 |
| β-strand | 182-184 | 3 | 3 |
| β-strand | 194-209 | 16 | 4 |
| β-strand | 211-224 | 14 | 4 |
| α-helix | 227-229 | 3 | |
| α-helix | 230-234 | 5 | |
| α-helix | 235-244 | 10 | |
| α-helix | 245-249 | 5 | |
| α-helix | 255-279 | 25 | |
| α-helix | 288-314 | 27 | |
| α-helix | 318-417 | 30 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 16-26 | 11 | |
| α-helix | 34 | 1 | |
| β-strand | 42-57 | 16 | 5 |
| β-strand | 62-74 | 13 | 5 |
| α-helix | 76-78 | 3 | |
| β-strand | 86-89 | 4 | 5 |
| α-helix | 91-94 | 4 | |
| β-strand | 102-104 | 3 | 6 |
| β-strand | 107-112 | 6 | 5 |
| β-strand | 120-125 | 6 | 5 |
| β-strand | 129-141 | 13 | 5 |
| β-strand | 153-156 | 4 | 6 |
| β-strand | 159-162 | 4 | 6 |
| β-strand | 170-174 | 5 | 5 |
| β-strand | 182-184 | 3 | 5 |
| β-strand | 194-209 | 16 | 6 |
| β-strand | 211-224 | 14 | 6 |
| α-helix | 227-229 | 3 | |
| α-helix | 230-234 | 5 | |
| α-helix | 235-244 | 10 | |
| α-helix | 245-249 | 5 | |
| α-helix | 255-279 | 25 | |
| α-helix | 288-313 | 26 | |
| α-helix | 318-417 | 30 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 16-26 | 11 | |
| α-helix | 34 | 1 | |
| β-strand | 42-57 | 16 | 7 |
| β-strand | 62-74 | 13 | 7 |
| α-helix | 76-78 | 3 | |
| β-strand | 86-89 | 4 | 7 |
| α-helix | 91-94 | 4 | |
| β-strand | 102-104 | 3 | 8 |
| β-strand | 107-112 | 6 | 7 |
| β-strand | 120-125 | 6 | 7 |
| β-strand | 129-141 | 13 | 7 |
| β-strand | 153-156 | 4 | 8 |
| β-strand | 159-162 | 4 | 8 |
| β-strand | 170-174 | 5 | 7 |
| β-strand | 182-188 | 7 | 7 |
| β-strand | 194-209 | 16 | 8 |
| β-strand | 211-224 | 14 | 8 |
| α-helix | 227-229 | 3 | |
| α-helix | 230-234 | 5 | |
| α-helix | 235-244 | 10 | |
| α-helix | 247-249 | 3 | |
| α-helix | 255-279 | 25 | |
| α-helix | 288-314 | 27 | |
| α-helix | 318-417 | 30 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 16-26 | 11 | |
| α-helix | 34 | 1 | |
| β-strand | 42-52 | 11 | 9 |
| β-strand | 56-57 | 2 | 9 |
| β-strand | 62-74 | 13 | 9 |
| α-helix | 76-78 | 3 | |
| β-strand | 86-89 | 4 | 9 |
| α-helix | 91-94 | 4 | |
| β-strand | 102-104 | 3 | 10 |
| β-strand | 107-112 | 6 | 9 |
| β-strand | 120-125 | 6 | 9 |
| β-strand | 129-141 | 13 | 9 |
| β-strand | 153-156 | 4 | 10 |
| β-strand | 159-162 | 4 | 10 |
| β-strand | 170-174 | 5 | 9 |
| β-strand | 182-184 | 3 | 9 |
| β-strand | 194-209 | 16 | 10 |
| β-strand | 211-224 | 14 | 10 |
| α-helix | 227-229 | 3 | |
| α-helix | 230-234 | 5 | |
| α-helix | 235-245 | 11 | |
| α-helix | 247-249 | 3 | |
| α-helix | 255-279 | 25 | |
| α-helix | 288-313 | 26 | |
| α-helix | 318-417 | 30 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Gamma-aminobutyric acid receptor subunit alpha-5 | A, B, C, D, E | protein | 361 | Homo sapiens | P31644 (AlphaFold model) |
>8BGI_1 Gamma-aminobutyric acid receptor subunit alpha-5 (chains A, B, C, D, E) QMPTSSVKDETNDNITIFTRILDGLLDGYDNRLRPGLGERITQVRTDMYVNSFGPVSDTE MEYTIDIFFAQTWKDERLRFKGPMQRLPLDNRVADQIWTPDTFFHNDKKSFAHGMTTPNK MLRIWNDGRVLYTMRLTISAECPMDLEDFPMDEQNCPLKFGSYAYPNSEVVYVWTNGSTK SVVVAEDGSRLNQYHLMGQTVGTENISTSTGEYTIMTAHFHLKRKIGYFVIQTYLPCIMT VILSQVSFWLNRESVPARTVFGVTTVLTMTTLSISARNSLPKVAYATAMDWFIAVCYAFV FSALIEFATVNYFTKSQPARAAKIDKMSRIVFPILFGTFNLVYWATYLNRGTTETSQVAP A
| ID | Name | Formula | Copies |
|---|---|---|---|
| NAG | 2-acetamido-2-deoxy-beta-D-glucopyranose | C8 H15 N O6 | 6 |
| P9N | Pregnanolone | C21 H34 O2 | 5 |
| FYP | ethyl 8-fluoro-5-methyl-6-oxo-5,6-dihydro-4H-imidazo[1,5-a][1,4]benzodiazepine-… | C15 H14 F N3 O3 | 5 |
Water and common crystallization additives (SO4) are not listed.
The molecular basis of drug selectivity for alpha 5 subunit-containing GABA A receptors. Kasaragod, V.B., Malinauskas, T., Wahid, A.A. et al. Nat Struct Mol Biol (2023) 30:1936-1946. DOI 10.1038/s41594-023-01133-1 · PubMed
Other PDB entries of the same protein (UniProt P31644 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8BGI directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.