8BJS: Apo KIF20A[55-510] crystal structure

Apo KIF20A[55-510] crystal structure. Determined by X-ray diffraction at 2.73 Å resolution. Released 4 Oct 2023.

Method: X-ray diffraction
Resolution: 2.73 Å
Organism: Mus musculus
Chains: 2
Atoms: 2,798
Mol. weight: 52.9 kDa
Released: 4 Oct 2023

Explore 8BJS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8BJS contains 14 α-helices and 23 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	65-70	6	1
α-helix	71-74	4
α-helix	75-79	5
β-strand	87-91	5	2
β-strand	94-98	5	2
β-strand	117-121	5	2
β-strand	124-126	3	1
α-helix	132-138	7
α-helix	140-149	10
β-strand	153-158	6	1
α-helix	165-169	5
β-strand	171	1	3
β-strand	176	1	3
α-helix	178-190	13
β-strand	194	1	1
β-strand	200-201	2	4
β-strand	207-208	2	5
β-strand	209-210	2	4
α-helix	213-227	15
α-helix	287-291	5
β-strand	296-308	13	1
β-strand	311-314	4	1
β-strand	328	1	1
β-strand	330-332	3	6
β-strand	338-340	3	6
β-strand	346-348	3	1
α-helix	351-367	17
β-strand	380-391	12	1
β-strand	397-407	11	1
α-helix	432-445	14
α-helix	458-460	3
α-helix	462-466	5
α-helix	468-470	3
β-strand	476-483	8	1
α-helix	490-500	11
β-strand	503-506	4	2

Chain U: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	252-253	2	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinesin-like protein KIF20A	A	protein	465	Mus musculus	P97329 (AlphaFold model)
Unk-unk-unk-unk	U	protein	4	Mus musculus

Sequence of entity 1 (A), FASTA

>8BJS_1 Kinesin-like protein KIF20A (chains A)
MALLEDTSEKVKVYLRIRPFLTSELDRQEDQGCVCIENTETLVLQAPKDSFALKSNERGV
GQATHKFTFSQIFGPEVGQVAFFNLTMKEMVKDVLKGQNWLIYTYGVTNSGKTYTIQGTS
KDAGILPQSLALIFNSLQGQLHPTPDLKPLLSNEVIWLDSKQIRQEEMKKLSLLIGGLQE
EELSTSVKKRVHTESRIGASNSFDSGVAGLSSTSQFTSSSQLDETSQLWAQPDTVPVSVP
ADIRFSVWISFFEIYNELLYDLLEPPSHQHKRQTLRLCEDQNGNPYVKDLNWIHVRDVEE
AWKLLKVGRKNQSFASTHMNQQSSRSHSIFSIRILHLQGEGDIVPKISELSLCDLAGSER
CKHQKSGERLKEAGNINTSLHTLGRCIAALRQNQQNRSKQNLIPFRDSKLTRVFQGFFTG
RGRSCMIVNVNPCASTYDETLHAAKFSALASQLVHAPLEHHHHHH

Sequence of entity 2 (U), FASTA

>8BJS_2 UNK-UNK-UNK-UNK (chains U)
XXXX

Primary citation

Nucleotide-free structures of KIF20A illuminate atypical mechanochemistry in this kinesin-6. Ranaivoson, F.M., Crozet, V., Benoit, M.P.M.H. et al. Open Biol (2023) 13:230122-230122. DOI 10.1098/rsob.230122 · PubMed

Other PDB entries of the same protein (UniProt P97329 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5LEF 2.09 Å, Rab6A:Kif20A complex
8F1A 3.1 Å, Apo KIF20A[1-565] class-1 in complex with a microtubule
8F18 3.2 Å, Apo KIF20A[1-565] class-2 in complex with a microtubule
5ND4 4.4 Å, Microtubule-bound MKLP2 motor domain in the presence of ADP.AlFx
5ND2 5.8 Å, Microtubule-bound MKLP2 motor domain in the presence of ADP
5ND3 6.1 Å, Microtubule-bound MKLP2 motor domain in the with no nucleotide
5ND7 7.9 Å, Microtubule-bound MKLP2 motor domain in the presence of AMPPNP

Browse structure collections

About this viewer

MolViewer shows 8BJS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.