Crystal structure of JAK2 JH1 in complex with momelotinib. Determined by X-ray diffraction at 1.3 Å resolution. Released 20 Dec 2023.
Explore 8BXH in 3D Show helices and sheets RCSB PDB PDBe
8BXH contains 20 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 836-838 | 3 | |
| α-helix | 846-848 | 3 | |
| β-strand | 849-857 | 9 | 1 |
| β-strand | 861-868 | 8 | 1 |
| β-strand | 877-884 | 8 | 1 |
| α-helix | 889-903 | 15 | |
| β-strand | 910 | 1 | 2 |
| α-helix | 911-912 | 2 | |
| β-strand | 913-917 | 5 | 1 |
| α-helix | 919-922 | 4 | |
| β-strand | 926-930 | 5 | 1 |
| β-strand | 936 | 1 | 2 |
| α-helix | 937-943 | 7 | |
| α-helix | 945-947 | 3 | |
| α-helix | 950-969 | 20 | |
| β-strand | 972-973 | 2 | 3 |
| α-helix | 979-981 | 3 | |
| β-strand | 982-986 | 5 | 2 |
| β-strand | 989-992 | 4 | 2 |
| β-strand | 999-1000 | 2 | 3 |
| α-helix | 1001-1002 | 2 | |
| β-strand | 1008-1009 | 2 | 4 |
| α-helix | 1018-1020 | 3 | |
| α-helix | 1023-1028 | 6 | |
| β-strand | 1030-1031 | 2 | 4 |
| α-helix | 1033-1049 | 17 | |
| α-helix | 1057-1065 | 9 | |
| α-helix | 1072-1083 | 12 | |
| α-helix | 1088-1091 | 4 | |
| α-helix | 1096-1105 | 10 | |
| α-helix | 1110-1112 | 3 | |
| α-helix | 1114-1115 | 2 | |
| α-helix | 1116-1129 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tyrosine-protein kinase JAK2 | A | protein | 316 | Homo sapiens | O60674 (AlphaFold model) |
>8BXH_1 Tyrosine-protein kinase JAK2 (chains A) MHHHHHHSSGVDLGTENLYFQSMDPTQFEERHLKFLQQLGKGNFGSVEMCRYDPLQDNTG EVVAVKKLQHSTEEHLRDFEREIEILKSLQHDNIVKYKGVCYSAGRRNLKLIMEYLPYGS LRDYLQKHKERIDHIKLLQYTSQICKGMEYLGTKRYIHRDLATRNILVENENRVKIGDFG LTKVLPQDKEYYKVKEPGESPIFWYAPESLTESKFSVASDVWSFGVVLYELFTYIEKSKS PPAEFMRMIGNDKQGQMIVFHLIELLKNNGRLPRPDGCPDEIYMIMTECWNNNVNQRPSF RDLALRVDQIRDNMAG
Functional and Structural Characterization of Clinical-Stage Janus Kinase 2 Inhibitors Identifies Determinants for Drug Selectivity. Miao, Y., Virtanen, A., Zmajkovic, J. et al. J Med Chem (2024) 67:10012-10024. DOI 10.1021/acs.jmedchem.4c00197 · PubMed
Other PDB entries of the same protein (UniProt O60674 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8BXH directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.