8BZC: 14-3-3 protein sigma

co-soaked stabilizers for ERa - 14-3-3 interaction (884_AZ244). Determined by X-ray diffraction at 1.1 Å resolution. Released 27 Dec 2023.

Method: X-ray diffraction
Resolution: 1.1 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,290
Mol. weight: 27.78 kDa
Ligands: SG0, GEH, MG
Released: 27 Dec 2023

Explore 8BZC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8BZC contains 15 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	3-15	13
α-helix	19-30	12
α-helix	35-37	3
α-helix	38-69	32
α-helix	74-76	3
α-helix	80-102	23
α-helix	103-107	5
α-helix	108-110	3
α-helix	114-134	21
α-helix	140-161	22
α-helix	167-178	12
α-helix	179-183	5
α-helix	187-204	18
α-helix	205-207	3
α-helix	210-230	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
14-3-3 protein sigma	A	protein	236	Homo sapiens	P31947 (AlphaFold model)
ERalpha peptide	B	protein	5	Homo sapiens	P03372 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8BZC_1 14-3-3 protein sigma (chains A)
GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSNEERCLLSVAYKNVVGGQ
RAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAE
SRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALN
FSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT

Sequence of entity 2 (B), FASTA

>8BZC_2 ERalpha peptide (chains B)
FPATV

Ligands and cofactors

ID	Name	Formula	Copies
SG0	4-[(~{R})-azanyl(oxidanyl)methyl]-7-propan-2-yloxy-1-benzothiophene-2-carboximi…	C13 H17 N3 O2 S	1
GEH	2-(4-chloranylphenoxy)-2-methyl-~{N}-(2-sulfanylethyl)propanamide	C12 H16 Cl N O2 S	1
MG	Magnesium ion	Mg	3

Primary citation

Linked-fragment stabilizers of 14-3-3 protein-protein interactions. Visser, E.J., Jaishankar, P., Sijbesma, E. et al. To be published.

Other PDB entries of the same protein (UniProt P31947 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3IQU 1.05 Å, Crystal Structure of human 14-3-3 sigma in Complex with Raf1 peptide (6mer)
7AZ2 1.08 Å, 14-3-3 sigma with Pin1 binding site pS72 and covalently bound LvD1014
6HMT 1.1 Å, Ternary complex of Estrogen Receptor alpha peptide and 14-3-3 sigma C42 mutant bound to…
7BAA 1.1 Å, Cys-42-tethered stabilizer 12 of 14-3-3(sigma)/ERa PPI
8BZW 1.1 Å, Co-soaked stabilizers for ERa - 14-3-3 interaction (844_AZ210)
8C04 1.1 Å, Co-soaked stabilizers for ERa - 14-3-3 interaction (884_AZ354)
9GG8 1.1 Å, Crystal structure of 14-3-3 sigma dC - C38N in complex with Tau pS214 peptide and…
8ANC 1.11 Å, 14-3-3 sigma sirtuin-3 phospho-peptide complex
6Y1J 1.13 Å, 14-3-3 sigma in complex with IkappaBalpha pS63 peptide
6G6X 1.13 Å, 14-3-3sigma in complex with a P129beta3P mutated YAP pS127 phosphopeptide
6NV2 1.13 Å, 14-3-3 sigma with RelA/p65 binding site pS45 in complex with DP005
3IQJ 1.15 Å, Crystal Structure of human 14-3-3 sigma in Complex with Raf1 peptide (10mer)

Browse structure collections

About this viewer

MolViewer shows 8BZC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.