8BZR: UFC1-UFM1 conjugate

Name: PDB 8BZR: UFC1-UFM1 conjugate
Published: 2023-12-27
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

UFC1-UFM1 conjugate. Determined by X-ray diffraction at 1.78 Å resolution. Released 27 Dec 2023.

Method: X-ray diffraction
Resolution: 1.78 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,061
Mol. weight: 29.42 kDa
Released: 27 Dec 2023

Explore 8BZR in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8BZR contains 14 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	1-11	11
α-helix	14-16	3
α-helix	22-24	3
α-helix	26-48	23
β-strand	54-58	5	1
β-strand	64-73	10	1
β-strand	76-85	10	1
α-helix	94-97	4
β-strand	98	1	1
α-helix	100-102	3
β-strand	109	1	2
α-helix	111-113	3
β-strand	114	1	1
β-strand	115	1	2
α-helix	121-126	6
α-helix	134-137	4
α-helix	138-142	5
α-helix	143-155	13

Chain B: 3 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	3-10	8	3
β-strand	18-24	7	3
β-strand	28	1	4
α-helix	29-39	11
α-helix	44-46	3
β-strand	47-51	5	3
β-strand	56	1	3
β-strand	62	1	4
α-helix	63-69	7
β-strand	73-78	6	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-fold modifier-conjugating enzyme 1	A	protein	172	Homo sapiens	Q9Y3C8 (AlphaFold model)
Ubiquitin-fold modifier 1	B	protein	84	Homo sapiens	P61960 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8BZR_1 Ubiquitin-fold modifier-conjugating enzyme 1 (chains A)
GPLGSMADEATRRVVSEIPVLKTNAGPRDRELWVQRLKEEYQSLIRYVENNKNADNDWFR
LESNKEGTRWFGKCWYIHDLLKYEFDIEFDIPITYPTTAPEIAVPELDGKTAKMYRGGKI
KLTDHFKPLWARNVPKFGLAHLMALGLGPWLAVEIPDLIQKGVIQHKEKCNQ

Sequence of entity 2 (B), FASTA

>8BZR_2 Ubiquitin-fold modifier 1 (chains B)
GMSKVSFKITLTSDPRLPYKVLSVPESTPFTAVLKFAAEEFKVPAATSAIITNDGIGINP
AQTAGNVFLKHGSELRIIPRDRVG

Primary citation

The UFM1 E3 ligase recognizes and releases 60S ribosomes from ER translocons. Makhlouf, L., Peter, J.J., Magnussen, H.M. et al. Nature (2024) 627:437-444. DOI 10.1038/s41586-024-07093-w · PubMed

Other PDB entries of the same protein (UniProt Q9Y3C8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9GLH 1.11 Å, Crystal Structure of UFC1 T106S
9GLJ 1.21 Å, Crystal Structure of UFC1 T106A
9GMM 1.35 Å, Crystal Structure of UFC1 T106I
9GLI 1.43 Å, Crystal Structure of UFC1 T106C
9GLO 1.53 Å, Crystal Structure of UFC1 C116E&T106S
9I9M 1.54 Å, Crystal structure of chimeric UFC1, TAK MotiF replaced with HPN motif of other E2 proteins
2Z6O 1.6 Å, Crystal Structure of the Ufc1, Ufm1 conjugating enzyme 1
9GLL 1.65 Å, Crystal Structure of UFC1 T106L
9GLP 1.77 Å, Crystal Structure of UFC1 C116E&T106I
9GLM 1.79 Å, Crystal Structure of UFC1 W145F
2Z6P 1.8 Å, Crystal Structure of the Ufc1, Ufm1 conjugating enzyme 1
9I9N 1.88 Å, Crystal Structure of UFC1 C116E & K108A

Browse structure collections

About this viewer

MolViewer shows 8BZR directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.