8CIA: Kelch domain of human KLHL20

Crystal structure of the kelch domain of human KLHL20. Determined by X-ray diffraction at 3.72 Å resolution. Released 22 Mar 2023.

Method: X-ray diffraction
Resolution: 3.72 Å
Organism: Homo sapiens
Chains: 5
Atoms: 10,843
Mol. weight: 166.61 kDa
Released: 22 Mar 2023

Explore 8CIA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8CIA contains 19 α-helices and 194 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 37 β-strands

Element	Residues	Length	Sheet
β-strand	318-323	6	1
β-strand	335-338	4	1
β-strand	339	1	2
β-strand	344	1	2
β-strand	347-348	2	1
α-helix	349-351	3
β-strand	356	1	3
β-strand	359-363	5	4
β-strand	366-370	5	4
β-strand	373	1	3
β-strand	382-386	5	4
β-strand	391-396	6	4
β-strand	404	1	5
β-strand	408-411	4	6
β-strand	414-417	4	6
β-strand	421	1	5
β-strand	431	1	6
β-strand	442	1	6
β-strand	451	1	7
β-strand	454-457	4	8
β-strand	462-465	4	8
β-strand	468	1	7
β-strand	473	1	7
β-strand	477-481	5	8
β-strand	486-490	5	8
β-strand	498	1	9
β-strand	501-503	3	10
α-helix	505-507	3
β-strand	509-512	4	10
β-strand	515	1	9
β-strand	520	1	9
β-strand	524-528	5	10
β-strand	533-537	5	10
β-strand	545	1	11
β-strand	548-552	5	11
β-strand	555-562	8	11
β-strand	567-575	9	11
β-strand	580-584	5	11
β-strand	595-600	6	1

Chain B: 4 helices, 41 β-strands

Element	Residues	Length	Sheet
β-strand	318-323	6	12
β-strand	326	1	13
β-strand	331	1	13
β-strand	335-339	5	12
β-strand	344-348	5	12
α-helix	349-351	3
β-strand	356	1	14
β-strand	359-363	5	15
β-strand	366-370	5	15
β-strand	373	1	14
β-strand	378	1	14
β-strand	382	1	16
β-strand	383-386	4	15
β-strand	391-392	2	15
β-strand	396	1	16
α-helix	397-399	3
β-strand	404	1	17
β-strand	407-411	5	17
β-strand	414-421	8	17
β-strand	426-433	8	17
β-strand	434	1	18
β-strand	439	1	18
β-strand	442-443	2	17
β-strand	451	1	19
β-strand	454-458	5	20
β-strand	461-465	5	20
β-strand	468	1	19
β-strand	473	1	19
β-strand	477-480	4	20
β-strand	487-490	4	20
β-strand	498	1	21
β-strand	501-505	5	21
β-strand	508-515	8	21
β-strand	520-528	9	21
β-strand	533-537	5	21
α-helix	538-540	3
β-strand	548-552	5	22
β-strand	555-559	5	22
β-strand	562	1	23
β-strand	567	1	23
β-strand	572-575	4	22
α-helix	576-578	3
β-strand	580-583	4	22
β-strand	592	1	13
β-strand	596-600	5	12

Chain C: 5 helices, 37 β-strands

Element	Residues	Length	Sheet
β-strand	318-323	6	24
β-strand	326-327	2	25
β-strand	330-331	2	25
β-strand	335-339	5	24
β-strand	344-348	5	24
α-helix	350-351	2
β-strand	359-363	5	26
β-strand	366-370	5	26
β-strand	373	1	27
β-strand	378	1	27
β-strand	382-386	5	26
β-strand	391-393	3	26
α-helix	397-399	3
β-strand	404	1	28
β-strand	407-411	5	28
β-strand	414-422	9	28
β-strand	425-434	10	28
β-strand	439-443	5	28
α-helix	444-446	3
β-strand	451	1	29
β-strand	454-457	4	30
β-strand	462-465	4	30
β-strand	468	1	29
β-strand	473	1	29
β-strand	474	1	31
β-strand	477-479	3	30
β-strand	488-489	2	30
α-helix	491-493	3
β-strand	497	1	31
β-strand	501-504	4	32
β-strand	509-512	4	32
β-strand	515	1	33
β-strand	520	1	33
β-strand	524-528	5	32
β-strand	533-537	5	32
α-helix	538-540	3
β-strand	548-551	4	34
β-strand	556-562	7	34
β-strand	567-575	9	34
β-strand	580-586	7	34
β-strand	592	1	25
β-strand	596-600	5	24

Chain D: 4 helices, 41 β-strands

Element	Residues	Length	Sheet
β-strand	318-323	6	35
β-strand	326	1	36
β-strand	331	1	36
β-strand	335-339	5	35
β-strand	344-348	5	35
α-helix	349-351	3
β-strand	356	1	37
β-strand	359-362	4	38
β-strand	367-370	4	38
β-strand	373	1	37
β-strand	378	1	37
β-strand	382-386	5	38
β-strand	391-393	3	38
α-helix	397-399	3
β-strand	404-411	8	39
β-strand	414-421	8	39
β-strand	426	1	39
β-strand	430-433	4	39
β-strand	440-442	3	39
α-helix	444-446	3
β-strand	451	1	40
β-strand	454-457	4	41
β-strand	462-465	4	41
β-strand	468	1	40
β-strand	473	1	40
β-strand	474	1	42
β-strand	477-481	5	41
β-strand	486-490	5	41
β-strand	497	1	42
β-strand	502-504	3	43
β-strand	509-512	4	43
β-strand	515	1	44
β-strand	520	1	44
β-strand	524-528	5	43
β-strand	533-537	5	43
α-helix	538-540	3
β-strand	545	1	45
β-strand	548-552	5	46
β-strand	555-559	5	46
β-strand	562	1	45
β-strand	567	1	45
β-strand	571-575	5	46
β-strand	580-584	5	46
β-strand	592	1	36
β-strand	595-600	6	35

Chain E: 4 helices, 38 β-strands

Element	Residues	Length	Sheet
β-strand	318-323	6	47
β-strand	326-327	2	48
β-strand	330-331	2	48
β-strand	335-339	5	47
α-helix	340-342	3
β-strand	344-348	5	47
β-strand	356	1	49
β-strand	359-363	5	50
β-strand	366-370	5	50
β-strand	373	1	49
β-strand	378	1	49
β-strand	382-386	5	50
β-strand	391-393	3	50
β-strand	404	1	51
β-strand	407-411	5	52
β-strand	414-418	5	52
β-strand	421	1	51
β-strand	430-434	5	52
β-strand	439-442	4	52
α-helix	444-446	3
β-strand	451	1	53
β-strand	454-458	5	54
β-strand	461-465	5	54
β-strand	468	1	53
β-strand	473	1	53
β-strand	477-481	5	54
β-strand	486-488	3	54
α-helix	489-492	4
β-strand	500-505	6	55
β-strand	508-513	6	55
β-strand	515	1	56
β-strand	520	1	56
β-strand	524-528	5	55
β-strand	533-537	5	55
α-helix	538-540	3
β-strand	545-552	8	57
β-strand	555-562	8	57
β-strand	567	1	57
β-strand	571-575	5	57
β-strand	580-584	5	57
β-strand	592	1	48
β-strand	595-600	6	47

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kelch-like protein 20	A, C, D	protein	307	Homo sapiens	Q9Y2M5 (AlphaFold model)
Kelch like family member 20	B	protein	307	Homo sapiens	Q9Y2M5 (AlphaFold model)
Kelch like family member 20	E	protein	307	Homo sapiens	Q9Y2M5 (AlphaFold model)

Sequence of entity 1 (A, C, D), FASTA

>8CIA_1 Kelch-like protein 20 (chains A, C, D)
GHMSMQGPRTRPRKPIRAGEVLFAVGGWASGDAISSVERYDPQTNEWRMVASMSKRRCGV
GVSVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTARTSVGVAVLGGFLYAV
GGQDGVSALNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVE
RYNPQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPRTNQWSPVV
AMTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVFDPDANTWRLYGGMNYRRLGGGVGV
IKMTHAE

Sequence of entity 2 (B), FASTA

>8CIA_2 Kelch like family member 20 (chains B)
GHMSMQGPRTRPRKPIRAGEVLFAVGGWASGDAISSVERYDPQTNEWRMVASMSKRRCGV
GVSVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTARTSVGVAVLGGFLYAV
GGQDGVSALNIVERYDPKKNKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVE
RYNPQENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPRTNQWSPVV
AMTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVFDPDANTWRLYGGMNYRRLGGGVGV
IKMTHAE

Sequence of entity 3 (E), FASTA

>8CIA_3 Kelch like family member 20 (chains E)
GHMSMQGPRTRPRKPIRAGEVLFAVGGWASGDAISSVERYDPQTNEWRMVASMSKRRCGV
GVSVLDDLLYAVGGHDGSSYLNSVERYDPKTNQWSSDVAPTSTARTSVGVAVLGGFLYAV
GGQDGVSALNIVERYDPKENKWTRVASMSTRRLGVAVAVLGGFLYAVGGSDGTSPLNTVE
RYNPEENRWHTIAPMGTRRKHLGCAVYQDMIYAVGGRDDTTELSSAERYNPRTNQWSPVV
AMTSRRSGVGLAVVNGQLMAVGGFDGTTYLKTIEVFDPDANTWRLYGGMNYRRLGGGVGV
IKMTHAE

Primary citation

Crystal structure of the kelch domain of human KLHL20. Sweeney, M.N., Bradshaw, W.J., Chen, Z. et al. To be published.

Other PDB entries of the same protein (UniProt Q9Y2M5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6GY5 1.09 Å, Crystal structure of the kelch domain of human KLHL20 in complex with DAPK1 peptide
5YQ4 1.58 Å, Crystal structure of kelch domain of KLHL20

Browse structure collections

About this viewer

MolViewer shows 8CIA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.