Rhs2-CT endonuclease toxin in complex with cognate immunity protein RhsI2. Determined by X-ray diffraction at 2.17 Å resolution. Released 28 Aug 2024.
Explore 8CM0 in 3D Show helices and sheets RCSB PDB PDBe
8CM0 contains 19 α-helices and 11 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1294-1304 | 11 | |
| β-strand | 1306 | 1 | 3 |
| α-helix | 1307 | 1 | |
| α-helix | 1311-1313 | 3 | |
| α-helix | 1314-1323 | 10 | |
| β-strand | 1326-1328 | 3 | 2 |
| α-helix | 1332-1357 | 26 | |
| α-helix | 1360-1362 | 3 | |
| α-helix | 1365 | 1 | |
| β-strand | 1366-1369 | 4 | 3 |
| α-helix | 1381-1383 | 3 | |
| β-strand | 1384-1387 | 4 | 3 |
| α-helix | 1419-1421 | 3 | |
| β-strand | 1425-1427 | 3 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-14 | 9 | |
| β-strand | 32-34 | 3 | 1 |
| α-helix | 38 | 1 | |
| α-helix | 39-43 | 5 | |
| α-helix | 53-56 | 4 | |
| β-strand | 58-59 | 2 | 1 |
| α-helix | 60-61 | 2 | |
| α-helix | 76-78 | 3 | |
| α-helix | 79-94 | 16 | |
| α-helix | 102-104 | 3 | |
| β-strand | 105-106 | 2 | 2 |
| β-strand | 109-110 | 2 | 2 |
| α-helix | 112-132 | 21 | |
| α-helix | 137-146 | 10 | |
| β-strand | 151-155 | 5 | 1 |
| β-strand | 158-161 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Immunity protein RhsI2 | B | protein | 162 | Serratia marcescens | A0ABF7SXG6 (AlphaFold model) |
| Rhs-family protein | A | protein | 162 | Serratia marcescens | A0ABC9II69 |
>8CM0_1 Immunity protein RhsI2 (chains B) MNEFDFDSLLQRIDSSCFFSRMGLPDVLDSRVILIENVEKVFVNPTDAEFKGYYDSVEWL PTSMTQEDPFYKVKEVLPKELTGLRIRVNKAVMNATKGLSKDKFNYGPHDFSLAARNGIC FAFREYVSEQYLHLGNKWEEVVGIYFSGHWPVGIAKDKIVTI
>8CM0_2 Rhs-family protein (chains A) MGSSHHHHHHSSGENLYFQGGSNCSTLDRIIGDANKVASRGGAITAKQAQILRDNLPVVQ RRSVFQNQMARKEFVRDQHYLMSQWEANTGRTWPTGATPHHIIPLESGGANKWWNLMPTH GTLPNHSLPGVPGPHAAGGVLRTTVQQSRKALPPGTITDLRL
An Rhs effector uses distinct target cell functions to intoxicate bacterial and fungal competitors. Avelar, G.M., Pankov, G., Sarapa, T. et al. bioRxiv (2025). DOI 10.1101/2025.10.28.685041
Other PDB entries of the same protein (UniProt A0ABF7SXG6 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8CM0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.