8CTK: SARS-CoV-2 M protein in a lipid nanodisc

Cryo-EM structure of SARS-CoV-2 M protein in a lipid nanodisc. Determined by electron microscopy at 3.52 Å resolution. Released 22 Jun 2022.

Method: Electron microscopy
Resolution: 3.52 Å
Organism: Severe acute respiratory syndrome coronavirus 2
Chains: 2
Atoms: 3,042
Mol. weight: 52.38 kDa
Released: 22 Jun 2022

Explore 8CTK in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8CTK contains 10 α-helices and 20 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and B: 5 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	18-37	20
α-helix	44-55	12
α-helix	57-70	14
α-helix	75-106	32
α-helix	109-112	4
β-strand	119-123	5	1
β-strand	128-132	5	1
β-strand	139-145	7	1
β-strand	148-151	4	1
β-strand	154-158	5	1
β-strand	167-172	6	1
β-strand	175-184	10	1
β-strand	187	1	2
β-strand	191	1	2
β-strand	193-202	10	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Membrane protein	A, B	protein	231	Severe acute respiratory syndrome coronavirus 2	P0DTC5 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8CTK_1 Membrane protein (chains A, B)
MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPV
TLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILL
NVPLHGTILTRPLLESELVIGAVILRGHLRIAGHHLGRCDIKDLPKEITVATSRTLSYYK
LGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQSNSLEVLFQ

Primary citation

Structure of SARS-CoV-2 M protein in lipid nanodiscs. Dolan, K.A., Dutta, M., Kern, D.M. et al. Elife (2022) 11. DOI 10.7554/eLife.81702 · PubMed

Other PDB entries of the same protein (UniProt P0DTC5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8CME 2.26 Å, Human Leukocyte Antigen class II allotype DR1 presenting SARS-CoV-2 Membrane peptide…
7VGR 2.7 Å, SARS-CoV-2 M protein dimer (long form) in complex with YN7756_1 Fab
7VGS 2.8 Å, SARS-CoV-2 M protein dimer (short form) in complex with YN7717_9 Fab
9CTW 3.01 Å, Cryo-EM structure of SARS-CoV-2 M (long conformation) in the presence of C1P
9CTU 3.03 Å, Cryo-EM structure of SARS-CoV-2 M (short conformation)bound to C1P
8W2E 3.06 Å, SARS-CoV-2 M protein dimer in complex with JNJ-9676 and Fab-B
9EXA 3.2 Å, SARS-CoV-2 M protein dimer (short form) in complex with Fab-B and CIM-834
9BF9 3.4 Å, Human LAG-3-HLA-DR1 complex

Browse structure collections

About this viewer

MolViewer shows 8CTK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.