8CZZ: CRF01_AE T/F100 HIV-1 gp120

Cryo-EM structure of T/F100 SOSIP.664 HIV-1 Env trimer with LMHS mutations in complex with Temsavir, 8ANC195, and 10-1074. Determined by electron microscopy at 3.14 Å resolution. Released 31 May 2023.

Method: Electron microscopy
Resolution: 3.14 Å
Organisms: Human immunodeficiency virus 1, Homo sapiens
Chains: 18
Atoms: 26,288
Mol. weight: 537.67 kDa
Ligands: NAG, 83J
Released: 31 May 2023

Explore 8CZZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8CZZ contains 78 α-helices and 279 β-strands across 18 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 13 helices, 41 β-strands

Element	Residues	Length	Sheet
β-strand	35-40	6	1
β-strand	45-47	3	2
β-strand	53-55	3	3
β-strand	62	1	4
β-strand	65	1	4
β-strand	67	1	5
α-helix	79-81	3
β-strand	83-85	3	2
β-strand	91-93	3	6
α-helix	99-116	18
α-helix	120	1
β-strand	121	1	7
β-strand	129-131	3	8
β-strand	157-162	6	8
β-strand	169-174	6	8
β-strand	181-183	3	8
β-strand	190-193	4	8
α-helix	194-196	3
β-strand	201-203	3	7
α-helix	204-205	2
β-strand	209	1	5
β-strand	215	1	9
β-strand	216-218	3	3
β-strand	223-227	5	2
β-strand	237-239	3	6
β-strand	243-245	3	2
β-strand	247	1	3
α-helix	248-250	3
β-strand	251	1	9
β-strand	259-261	3	10
β-strand	271-273	3	10
β-strand	284-298	15	10
β-strand	304-312	7	11
β-strand	315-320	6	11
α-helix	321A-323	3
β-strand	330-333	4	10
α-helix	335-352	18
β-strand	357-361	4	10
α-helix	369-372	4
β-strand	374-377	4	12
β-strand	382-385	4	12
β-strand	393-395	3	10
α-helix	413	1
β-strand	414-417	4	10
β-strand	418-420	3	12
β-strand	423-425	3	7
β-strand	433-435	3	7
α-helix	436-438	3
β-strand	443-456	14	10
α-helix	457-458	2
β-strand	465-470	6	10
α-helix	475-480	6
β-strand	486-491	6	2
β-strand	494-499	6	1

Chain B: 7 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	530-535	6
α-helix	537-542	6
α-helix	570-595	26
β-strand	603-609	7	1
α-helix	610-611	2
α-helix	619-623	5
α-helix	628-634	7
α-helix	639-661	23

Chain C: 2 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	13
β-strand	10-11	2	14
β-strand	17-25	9	13
β-strand	33-38	7	15
β-strand	46-52	7	15
β-strand	57-59	3	15
β-strand	68-72	5	13
β-strand	77D-82A	7	13
α-helix	84-86	3
β-strand	88-90	3	14
β-strand	91-96	6	15
α-helix	100-100B	3
β-strand	100E-100F	2	16
β-strand	100I-100J	2	16
β-strand	102-103	2	15
β-strand	107-110	4	14

Chain D: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	17
β-strand	10-12	3	18
β-strand	19-25	7	17
β-strand	33-38	6	18
α-helix	39	1
β-strand	46-49	4	18
β-strand	53-54	2	18
β-strand	62-67	6	17
β-strand	70-75	6	17
α-helix	80-82	3
β-strand	84-90	7	18
α-helix	96	1
β-strand	97-98	2	18
β-strand	102-105	4	18

Chain E: 14 helices, 43 β-strands

Element	Residues	Length	Sheet
β-strand	35-40	6	19
β-strand	45-47	3	20
β-strand	53-55	3	21
β-strand	56	1	22
β-strand	67	1	23
β-strand	77	1	22
β-strand	84-85	2	20
α-helix	86-87	2
β-strand	91-94	4	24
α-helix	95-97	3
α-helix	99-116	18
α-helix	123-125	3
β-strand	129-131	3	25
β-strand	156-162	7	25
β-strand	169-175	7	25
α-helix	178-180	3
β-strand	181-183	3	25
β-strand	189-193	5	25
β-strand	201-203	3	26
α-helix	204-205	2
β-strand	209	1	23
β-strand	215	1	27
β-strand	216-218	3	21
β-strand	223-227	5	20
β-strand	236-239	4	24
β-strand	243-245	3	20
β-strand	247	1	21
α-helix	248-250	3
β-strand	251	1	27
β-strand	259	1	28
α-helix	264-266	3
β-strand	271-273	3	28
β-strand	283-298	16	28
β-strand	301	1	29
β-strand	304-312	7	30
β-strand	315-320	6	30
α-helix	321-322	3
β-strand	323	1	29
β-strand	330-333	4	28
α-helix	337-352	16
β-strand	357-361	4	28
α-helix	369-372	4
β-strand	374-377	4	31
β-strand	382-385	4	31
β-strand	393-395	3	28
α-helix	413	1
β-strand	414-417	4	28
β-strand	418	1	31
β-strand	421	1	31
β-strand	423-425	3	26
α-helix	426	1
α-helix	427-429	3
β-strand	433-435	3	26
β-strand	443-456	14	28
β-strand	465-470	6	28
β-strand	486-491	6	20
β-strand	494-499	6	19

Chain F: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	529	1	32
α-helix	530-535	6
α-helix	570-595	26
β-strand	603-609	7	19
α-helix	610-611	2
α-helix	619-625	7
β-strand	627	1	32
α-helix	628-634	7
α-helix	640-661	22

Chain G: 2 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	33
β-strand	10-11	2	34
β-strand	18-25	8	33
β-strand	33-39	8	35
α-helix	44	1
β-strand	45-52	8	35
β-strand	56-59	4	35
β-strand	67-72	6	33
β-strand	75	1	36
β-strand	77A	1	36
β-strand	77D-82	6	33
α-helix	84-86	3
β-strand	88	1	34
β-strand	89-96	8	35
β-strand	100E-100F	2	37
β-strand	100I-100J	2	37
β-strand	102-103	2	35
β-strand	109-110	2	34

Chain H: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	38
β-strand	10-13	4	39
β-strand	18-25	8	38
β-strand	33-38	6	39
β-strand	45-49	5	39
β-strand	53-54	2	39
β-strand	63-67	5	38
β-strand	70-76	7	38
β-strand	85-90	6	39
α-helix	96	1
β-strand	97-98	2	39
β-strand	102-106	5	39

10 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CRF01_AE T/F100 HIV-1 gp120	A, E, I	protein	486	Human immunodeficiency virus 1	A0A140EMT3
CRF-1_AE T/F100 HIV-1 gp41	B, F, J	protein	155	Human immunodeficiency virus 1	A0A2R8G1F7
Heavy chain of 8ANC195 Fab	C, G, K	protein	238	Homo sapiens
Light chain of 8ANC195 Fab	D, H, L	protein	215	Homo sapiens
Heavy chain of 10-1074 Fab	M, O, Q	protein	238	Homo sapiens
Light chain of 10-1074 Fab	N, P, R	protein	214	Homo sapiens

Sequence of entity 1 (A, E, I), FASTA

>8CZZ_1 CRF01_AE T/F100 HIV-1 gp120 (chains A, E, I)
ATNNLWVTVYYGVPVWRDADTTLFCASDAKAYETEVHNVWATHACVPTDPNPQEMHLKNV
TENFNMWKNNMVEQMHEDIISLWDQSLKPCVKLTPLCVTLNCTSATVTNYTKVNDTSDII
GNITDDVRNCSFNMTTELRDKQQKVYALFYKLDIVPIDDSSNNGSSNFSEYRLINCNTSV
IKQACPKVSFDPIPIHYCTPAGYAILRCNDKKFNGTGPCKNVSSVQCTHGIKPVVSTQLL
LNGSLAEEGIIIRSENLTNNAKTIIVHFNESVKINCTRPSNNTRTGIHIGPGQVFYKTGD
IIGDIRKAYCNISGAQWHKVLGRVANKLKEHFNNKTIVFKPSSGGDPEITMHSFNCRGEF
FYCNTTKLFNSTWGGNKNETRDNGTITIPCRIKQIINMWQGVGQAMYAPPIKGVIKCLSN
ITGILLTRDGGNDSTENNETFRPGGGDMRDNWRNELYKYKVVQIEPLGIAPTKCKRRVVE
RRRRRR

Sequence of entity 2 (B, F, J), FASTA

>8CZZ_2 CRF-1_AE T/F100 HIV-1 gp41 (chains B, F, J)
AVGLGAMIFGFLGAAGSTMGAASITLTVQARQLLSGIVQQQSNLLRAPEAQQHLLQLTVW
GIKQLQARVLAVERYLQDQKFLGLWGCSGKIICCTAVPWNSSWSNKTFEEIWNNMTWIEW
EREISNYTSQIYDILTISQTQQEKNEKDLLELDAA

Sequence of entity 3 (C, G, K), FASTA

>8CZZ_3 Heavy chain of 8ANC195 Fab (chains C, G, K)
QIHLVQSGTEVKKPGSSVTVSCKAYGVNTFGLYAVNWVRQAPGQSLEYIGQIWRWKSSAS
HHFRGRVLISAVDLTGSSPPISSLEIKNLTSDDTAVYFCTTTSTYDRWSGLHHDGVMAFS
SWGQGTLISVSAASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS
GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKT

Sequence of entity 4 (D, H, L), FASTA

>8CZZ_4 Light chain of 8ANC195 Fab (chains D, H, L)
DIQMTQSPSTLSASTGDTVRISCRASQSITGNWVAWYQQRPGKAPRLLIYRGAALLGGVP
SRFRGSAAGTDFTLTIGNLQAEDFGTFYCQQYDTYPGTFGQGTKVEVKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 5 (M, O, Q), FASTA

>8CZZ_5 Heavy chain of 10-1074 Fab (chains M, O, Q)
QVQLQESGPGLVKPSETLSVTCSVSGDSMNNYYWTWIRQSPGKGLEWIGYISDRESATYN
PSLNSRVVISRDTSKNQLSLKLNSVTPADTAVYYCATARRGQRIYGVVSFGEFFYYYSMD
VWGKGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTS
GVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPKSCDKT

Sequence of entity 6 (N, P, R), FASTA

>8CZZ_6 Light chain of 10-1074 Fab (chains N, P, R)
SYVRPLSVALGETARISCGRQALGSRAVQWYQHRPGQAPILLIYNNQDRPSGIPERFSGT
PDINFGTRATLTISGVEAGDEADYYCHMWDSRSGFSWSFGGATRLTVLGQPKAAPSVTLF
PPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYL
SLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	34
83J	1-[4-(benzenecarbonyl)piperazin-1-yl]-2-[4-methoxy-7-(3-methyl-1H-1,2,4-triazol…	C24 H23 N7 O4	3

Primary citation

Structure-function analyses reveal key molecular determinants of HIV-1 CRF01_AE resistance to the entry inhibitor temsavir. Prevost, J., Chen, Y., Zhou, F. et al. Nat Commun (2023) 14:6710-6710. DOI 10.1038/s41467-023-42500-2 · PubMed

Other PDB entries of the same protein (UniProt A0A140EMT3), best resolution first:

8DOK 3.2 Å, Cryo-EM structure of T/F100 SOSIP.664 HIV-1 Env trimer in complex with 8ANC195 and 10-1074
6NQD 3.9 Å, Cryo-EM structure of T/F100 SOSIP.664 HIV-1 Env trimer in complex with 8ANC195 Fab

Browse structure collections

About this viewer

MolViewer shows 8CZZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.