8D7E: Human CNTFR alpha

Cryo-EM structure of human CNTFR alpha in complex with the Fab fragments of two antibodies. Determined by electron microscopy at 2.93 Å resolution. Released 29 Mar 2023.

Method: Electron microscopy
Resolution: 2.93 Å
Organism: Homo sapiens
Chains: 5
Atoms: 8,959
Mol. weight: 135.21 kDa
Released: 29 Mar 2023

Explore 8D7E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8D7E contains 27 α-helices and 107 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain C: 6 helices, 24 β-strands

Element	Residues	Length	Sheet
α-helix	30-31	2
β-strand	32-37	6	1
β-strand	42-44	3	2
β-strand	55-59	5	1
β-strand	62-63	2	1
α-helix	64-65	2
α-helix	66-68	3
β-strand	69-70	2	2
β-strand	73-76	4	2
β-strand	85-91	7	1
β-strand	97-106	10	1
β-strand	113-117	5	3
β-strand	118	1	4
β-strand	126-130	5	3
β-strand	140-147	8	5
β-strand	150-151	2	5
α-helix	175-176	2
β-strand	177-184	8	5
β-strand	189-196	8	5
β-strand	202	1	4
α-helix	204-207	4
β-strand	211-213	3	6
β-strand	223-225	3	6
β-strand	240-241	2	7
β-strand	243-248	6	8
β-strand	257-258	2	8
β-strand	264-266	3	6
β-strand	276-280	5	8
β-strand	283-284	2	7
α-helix	290-293	4

Chain D: 5 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	26
β-strand	18-25	8	26
α-helix	29-31	3
β-strand	34-39	6	27
β-strand	46-51	6	27
β-strand	58-60	3	27
β-strand	68-73	6	26
β-strand	78-83	6	26
α-helix	88-90	3
β-strand	92-99	8	27
β-strand	107-110	4	27
β-strand	114-116	3	27
β-strand	124	1	28
β-strand	127-131	5	29
β-strand	142-152	11	29
β-strand	153	1	28
β-strand	158-161	4	30
α-helix	162-164	3
β-strand	170-172	3	29
α-helix	173-175	3
β-strand	183-192	10	29
α-helix	193-195	3
β-strand	201-207	7	30
β-strand	212-218	7	30

Chain E: 5 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	20
β-strand	10-13	4	21
β-strand	19-29	11	20
β-strand	33-38	6	21
β-strand	45-49	5	21
β-strand	53-54	2	21
α-helix	55	1
β-strand	62-75	14	20
α-helix	80-82	3
β-strand	85-90	6	21
α-helix	96-97	2
β-strand	99	1	21
β-strand	103-107	5	21
β-strand	112	1	22
β-strand	117-119	3	23
α-helix	123-126	4
β-strand	130-140	11	23
β-strand	141	1	22
β-strand	146-150	5	24
β-strand	155	1	24
β-strand	160-164	5	23
β-strand	174-183	10	23
α-helix	184-189	6
β-strand	192-193	2	25
β-strand	194-198	5	24
β-strand	207	1	24
β-strand	210-211	2	25

Chain F: 5 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	14
β-strand	11-12	2	15
β-strand	17-25	9	14
α-helix	29-31	3
β-strand	34-39	6	16
β-strand	45-51	7	16
β-strand	58-60	3	16
β-strand	68-73	6	14
β-strand	78-84	7	14
α-helix	88-90	3
β-strand	92-94	3	17
β-strand	95-97	3	16
β-strand	111-113	3	17
β-strand	114-115	2	15
β-strand	124-128	5	18
β-strand	139-149	11	18
β-strand	155-158	4	19
α-helix	159-161	3
β-strand	163	1	19
β-strand	167-169	3	18
α-helix	170-172	3
β-strand	173-174	2	18
β-strand	180-189	10	18
α-helix	190-193	4
β-strand	199-204	6	19
β-strand	209-214	6	19

Chain G: 6 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	5-7	3	9
β-strand	10-13	4	10
β-strand	19-24	6	9
α-helix	28-29	2
α-helix	30-32	3
β-strand	34-39	6	10
β-strand	46-50	5	10
β-strand	54-55	2	10
β-strand	63-68	6	9
β-strand	71-76	6	9
α-helix	81-83	3
β-strand	86-91	6	10
β-strand	98-99	2	10
β-strand	103-107	5	10
β-strand	112	1	11
β-strand	115-119	5	12
α-helix	120-122	3
α-helix	123-128	6
β-strand	130-140	11	12
β-strand	141	1	11
β-strand	146-150	5	13
β-strand	155	1	13
β-strand	160-164	5	12
β-strand	174-183	10	12
α-helix	184-187	4
β-strand	192-198	7	13
β-strand	206-211	6	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ciliary neurotrophic factor receptor subunit alpha	C	protein	348	Homo sapiens	P26992 (AlphaFold model)
H4H25311P2 antibody Fab fragment light chain	G	protein	215	Homo sapiens
H4H25311P2 antibody Fab fragment heavy chain	F	protein	217	Homo sapiens
REGN8938 antibody Fab fragment light chain	E	protein	215	Homo sapiens
REGN8938 antibody Fab fragment heavy chain	D	protein	220	Homo sapiens

Sequence of entity 1 (C), FASTA

>8D7E_1 Ciliary neurotrophic factor receptor subunit alpha (chains C)
QRHSPQEAPHVQYERLGSDVTLPCGTANWDAAVTWRVNGTDLAPDLLNGSQLVLHGLELG
HSGLYACFHRDSWHLRHQVLLHVGLPPREPVLSCRSNTYPKGFYCSWHLPTPTYIPNTFN
VTVLHGSKIMVCEKDPALKNRCHIRYMHLFSTIKYKVSISVSNALGHNATAITFDEFTIV
KPDPPENVVARPVPSNPRRLEVTWQTPSTWPDPESFPLKFFLRYRPLILDQWQHVELSDG
TAHTITDAYAGKEYIIQVAAKDNEIGTWSDWSVAAHATPWTEEPRHLTTEAQAAETTTST
TSSLAPPPTTKICDPGELGSEQKLISEEDLGGEQKLISEEDLHHHHHH

Sequence of entity 2 (G), FASTA

>8D7E_2 H4H25311P2 antibody Fab fragment light chain (chains G)
EIVLTQSPGTLSLSPGERATLSCRASQSVSSSYLAWYQQKPGQAPRLLIYGASSRATGIP
DRFSGSGSGTDFTLTISRLEPEDFAVYYCQQYGSSPWTFGQGTKVEIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 3 (F), FASTA

>8D7E_3 H4H25311P2 antibody Fab fragment heavy chain (chains F)
QVQLVESGGGVVQPGRSLRLSCVASGFTFSTSVMHWVRQAPGKGLEWVANIWYDGINKFY
VDSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCAREFWSAFDLWGQGTMVTVSSAST
KGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLY
SLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVES

Sequence of entity 4 (E), FASTA

>8D7E_4 REGN8938 antibody Fab fragment light chain (chains E)
DIQMTQSPSSLSASVGDRVTITCRASQSISSYLNWYQQKPGKAPKLLIYAASSLQSGVPS
RFSGSGSGTDFTLTISSLQPEDFATYYCQQSYSTPPITFGQGTRLEIKRTVAAPSVFIFP
PSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTL
TLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 5 (D), FASTA

>8D7E_5 REGN8938 antibody Fab fragment heavy chain (chains D)
QVQLVESGGDVVQPGRSLRLSCAASGFTFSYYGMHWVRQPPGKGLEWVTIISFDGSQKYY
ADSVKGRFTISRDNSKNTVFLQMNSLRTEDTGFYYCAAQSSTWPEYFQYWGQGTLVTVSS
ASTKGPSVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSS
GLYSLSSVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVES

Primary citation

Structural insights into the assembly of gp130 family cytokine signaling complexes. Zhou, Y., Stevis, P.E., Cao, J. et al. Sci Adv (2023) 9:eade4395-eade4395. DOI 10.1126/sciadv.ade4395 · PubMed

Other PDB entries of the same protein (UniProt P26992 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8D74 3.03 Å, Cryo-EM structure of human CNTF signaling complex: model containing the interaction core…
8D7H 3.4 Å, Cryo-EM structure of human CLCF1 in complex with CRLF1 and CNTFR alpha
8D7R 3.9 Å, Cryo-EM structure of human CLCF1 signaling complex: model containing the interaction…
1UC6 Solution Structure of the Carboxyl Terminal Domain of the Ciliary Neurotrophic Factor…

Browse structure collections

About this viewer

MolViewer shows 8D7E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.