8EI1: N-terminal domain of CUL4B
Crystal structure of the N-terminal domain of CUL4B in complex with H316, a Helicon Polypeptide. Determined by X-ray diffraction at 2.89 Å resolution. Released 25 Oct 2023.
- Method
- X-ray diffraction
- Resolution
- 2.89 Å
- Organisms
- Homo sapiens, synthetic construct
- Chains
- 8
- Atoms
- 11,809
- Mol. weight
- 176.68 kDa
- Ligands
- WHL
- Released
- 25 Oct 2023
Explore 8EI1 in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8EI1 contains 96 α-helices and 2 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain A: 23 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 197-211 | 15 | |
| β-strand | 214 | 1 | 1 |
| α-helix | 219-232 | 14 | |
| α-helix | 235-251 | 17 | |
| α-helix | 254-257 | 4 | |
| α-helix | 264-288 | 25 | |
| α-helix | 290-298 | 9 | |
| α-helix | 304-305 | 2 | |
| α-helix | 306-314 | 9 | |
| α-helix | 315-319 | 5 | |
| α-helix | 322-340 | 19 | |
| α-helix | 347-359 | 13 | |
| α-helix | 363-368 | 6 | |
| α-helix | 369-389 | 21 | |
| α-helix | 392-412 | 21 | |
| α-helix | 416-418 | 3 | |
| α-helix | 419-430 | 12 | |
| α-helix | 432-434 | 3 | |
| α-helix | 435-448 | 14 | |
| α-helix | 452-463 | 12 | |
| α-helix | 468-487 | 20 | |
| α-helix | 497-514 | 18 | |
| α-helix | 520-533 | 14 | |
| α-helix | 534-536 | 3 | |
Chain B: 22 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 197-211 | 15 | |
| α-helix | 219-231 | 13 | |
| α-helix | 235-251 | 17 | |
| α-helix | 255-257 | 3 | |
| α-helix | 264-288 | 25 | |
| α-helix | 290-298 | 9 | |
| α-helix | 304-305 | 2 | |
| α-helix | 306-314 | 9 | |
| α-helix | 315-319 | 5 | |
| α-helix | 322-340 | 19 | |
| α-helix | 347-359 | 13 | |
| α-helix | 363-368 | 6 | |
| α-helix | 369-389 | 21 | |
| α-helix | 392-412 | 21 | |
| α-helix | 416-418 | 3 | |
| α-helix | 419-430 | 12 | |
| α-helix | 432-434 | 3 | |
| α-helix | 435-448 | 14 | |
| α-helix | 452-462 | 11 | |
| α-helix | 468-487 | 20 | |
| α-helix | 498-514 | 17 | |
| α-helix | 520-533 | 14 | |
Chain C: 23 helices, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 197-210 | 14 | |
| α-helix | 219-231 | 13 | |
| α-helix | 235-237 | 3 | |
| α-helix | 239-251 | 13 | |
| α-helix | 254-258 | 5 | |
| α-helix | 264-288 | 25 | |
| α-helix | 290-299 | 10 | |
| α-helix | 304-305 | 2 | |
| α-helix | 306-314 | 9 | |
| α-helix | 315-319 | 5 | |
| α-helix | 322-340 | 19 | |
| α-helix | 347-359 | 13 | |
| α-helix | 363-368 | 6 | |
| α-helix | 369-389 | 21 | |
| α-helix | 392-412 | 21 | |
| α-helix | 416-418 | 3 | |
| α-helix | 419-430 | 12 | |
| α-helix | 432-434 | 3 | |
| α-helix | 435-448 | 14 | |
| α-helix | 452-462 | 11 | |
| α-helix | 468-487 | 20 | |
| α-helix | 497-514 | 18 | |
| α-helix | 520-530 | 11 | |
Chain D: 24 helices, 1 β-strand
| Element | Residues | Length | Sheet |
|---|
| α-helix | 197-210 | 14 | |
| β-strand | 218 | 1 | 1 |
| α-helix | 219-231 | 13 | |
| α-helix | 238-251 | 14 | |
| α-helix | 255-258 | 4 | |
| α-helix | 264-288 | 25 | |
| α-helix | 290-298 | 9 | |
| α-helix | 304-305 | 2 | |
| α-helix | 306-314 | 9 | |
| α-helix | 315-319 | 5 | |
| α-helix | 322-340 | 19 | |
| α-helix | 347-359 | 13 | |
| α-helix | 363-368 | 6 | |
| α-helix | 369-389 | 21 | |
| α-helix | 392-412 | 21 | |
| α-helix | 416-418 | 3 | |
| α-helix | 419-430 | 12 | |
| α-helix | 432-434 | 3 | |
| α-helix | 435-438 | 4 | |
| α-helix | 439-443 | 5 | |
| α-helix | 444-448 | 5 | |
| α-helix | 452-462 | 11 | |
| α-helix | 468-487 | 20 | |
| α-helix | 497-514 | 18 | |
| α-helix | 520-530 | 11 | |
Chains E and F: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 2-16 | 15 | |
Chain G: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 6-15 | 10 | |
Chain H: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 8-15 | 8 | |
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| Cullin-4B | A, B, C, D | protein | 354 | Homo sapiens | Q13620 (AlphaFold model) |
| H316 | E, F, G, H | protein | 19 | synthetic construct | |
Sequence of entity 1 (A, B, C, D), FASTA
>8EI1_1 Cullin-4B (chains A, B, C, D)
SMPKLPENYTDETWQKLKEAVEAIQNSTSIKYNLEELYQAVENLCSYKISANLYKQLRQI
CEDHIKAQIHQFREDSLDSVLFLKKIDRCWQNHCRQMIMIRSIFLFLDRTYVLQNSMLPS
IWDMGLELFRAHIISDQKVQNKTIDGILLLIERERNGEAIDRSLLRSLLSMLSDLQIYQD
SFEQRFLEETNRLYAAEGQKLMQEREVPEYLHHVNKRLEEEADRLITYLDQTTQKSLIAT
VEKQLLGEHLTAILQKGLNNLLDENRIQDLSLLYQLFSRVRGGVQVLLQQWIEYIKAFGS
TIVINPEKDKTMRQELDDFKDKVDHIIDICFLKNEKFINAMKEAFETFINKRPN
Sequence of entity 2 (E, F, G, H), FASTA
>8EI1_2 H316 (chains E, F, G, H)
XDPADRWCELAAWTCDTFX
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| WHL | N,N'-(1,4-phenylene)diacetamide | C10 H12 N2 O2 | 4 |
Primary citation
Recognition and reprogramming of E3 ubiquitin ligase surfaces by alpha-helical peptides. Tokareva, O.S., Li, K., Travaline, T.L. et al. Nat Commun (2023) 14:6992-6992. DOI 10.1038/s41467-023-42395-z · PubMed
Other PDB entries of the same protein (UniProt Q13620 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 4A64 2.57 Å, Crystal structure of the N-terminal domain of human Cul4B at 2.57A resolution
- 4A0C 3.8 Å, Structure of the CAND1-CUL4B-RBX1 complex
- 4A0L 7.4 Å, Structure of DDB1-DDB2-CUL4B-RBX1 bound to a 12 bp abasic site containing DNA-duplex
- 2DO7 Solution structure of the winged helix-turn-helix motif of human CUL-4B
Browse structure collections
About this viewer
MolViewer shows 8EI1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.