8ENS: Beta'-COPI-WD40 domain

Crystal structure of beta'-COPI-WD40 domain in complex with SARS-CoV-2 spike tail hepta-peptide. Determined by X-ray diffraction at 1.45 Å resolution. Released 31 Jan 2024.

Method: X-ray diffraction
Resolution: 1.45 Å
Organisms: Saccharomyces cerevisiae, Severe acute respiratory syndrome coronavirus 2
Chains: 2
Atoms: 2,952
Mol. weight: 35.2 kDa
Released: 31 Jan 2024

Explore 8ENS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ENS contains 3 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	6-12	7	1
β-strand	16-21	6	2
β-strand	27-32	6	2
β-strand	36-41	6	2
β-strand	46-52	7	2
β-strand	58-64	7	3
α-helix	65-67	3
β-strand	69-74	6	3
β-strand	78-83	6	3
β-strand	89-94	6	3
β-strand	100-105	6	4
β-strand	111-116	6	4
β-strand	121-125	5	4
α-helix	126-128	3
β-strand	131-136	6	4
β-strand	143-148	6	5
β-strand	155-160	6	5
β-strand	164-169	6	5
β-strand	177-180	4	5
β-strand	189-192	4	6
β-strand	200-204	5	6
β-strand	209-214	6	6
β-strand	220-225	6	6
β-strand	231-236	6	7
β-strand	242-247	6	7
β-strand	252-256	5	7
β-strand	262-266	5	7
β-strand	273-278	6	1
α-helix	283-285	3
β-strand	286-291	6	1
β-strand	294-299	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Coatomer subunit beta'	A	protein	302	Saccharomyces cerevisiae	P41811 (AlphaFold model)
spike tail hepta-peptide	C	protein	7	Severe acute respiratory syndrome coronavirus 2	P0DTC2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8ENS_1 Coatomer subunit beta' (chains A)
SMKLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVR
AGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDL
TVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTL
TTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPT
LPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLS
LG

Sequence of entity 2 (C), FASTA

>8ENS_2 spike tail hepta-peptide (chains C)
GVKLHYT

Primary citation

A single C-terminal residue controls SARS-CoV-2 spike trafficking and incorporation into VLPs. Dey, D., Qing, E., He, Y. et al. Nat Commun (2023) 14:8358-8358. DOI 10.1038/s41467-023-44076-3 · PubMed

Other PDB entries of the same protein (UniProt P41811 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8EWX 1.24 Å, N-terminal WD40 domain of beta'-COPI subunit with two chains in the asymmetric unit
8F0E 1.31 Å, N-terminal WD40 domain of beta'-COPI subunit with four chains in the asymmetric unit
8HQV 1.4 Å, The complex structure of COPI cargo sorting module with HCoV-OC43 Spike KTSHxx sorting…
8HQW 1.41 Å, The complex structure of COPI cargo sorting module with MHV Spike Hxx sorting motif
4J73 1.44 Å, Crystal structure of beta'-COP/p25 complex
8ENW 1.45 Å, Crystal structure of beta'-COPI-WD40 domain in complex with SARS-CoV-2 clientized spike…
4J82 1.46 Å, Crystal structure of beta'-COP/Insig-2 complex
4J84 1.47 Å, Crystal structure of beta'-COP/Scyl1 complex
4J78 1.48 Å, Crystal structure of beta'-COP/Emp47p complex
4J86 1.48 Å, Crystal structure of beta'-COP/yWbp1 complex
8HQX 1.54 Å, The complex structure of COPI cargo sorting module with TAT-WDM peptide
4J79 1.56 Å, Crystal structure of beta'-COP/PEDVspike complex

Browse structure collections

About this viewer

MolViewer shows 8ENS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.