8FGZ: Androgen receptor

Crystal structure of mutant Androgen Receptor ligand binding domain L702H/H875Y/F877L with DHT. Determined by X-ray diffraction at 1.61 Å resolution. Released 12 Apr 2023.

Method: X-ray diffraction
Resolution: 1.61 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,107
Mol. weight: 30.59 kDa
Ligands: DHT
Released: 12 Apr 2023

Explore 8FGZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8FGZ contains 12 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	673-681	9
α-helix	698-721	24
α-helix	726-728	3
α-helix	731-757	27
β-strand	763-766	4	1
β-strand	769-771	3	1
α-helix	773-778	6
α-helix	782-797	16
α-helix	802-813	12
β-strand	816-818	3	2
α-helix	825-844	20
α-helix	851-887	37
α-helix	891-893	3
α-helix	894-902	9
α-helix	904-908	5
β-strand	912-914	3	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Androgen receptor	A	protein	258	Homo sapiens	P10275 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8FGZ_1 Androgen receptor (chains A)
SHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALHSSLNELGERQLVHVVKWAKA
LPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMY
SQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRI
IACKRKNPTSCSRRFYQLTKLLDSVQPIARELYQLTFDLLIKSHMVSVDFPEMMAEIISV
QVPKILSGKVKPIYFHTQ

Ligands and cofactors

ID	Name	Formula	Copies
DHT	5-alpha-dihydrotestosterone	C19 H30 O2	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

A partially open conformation of an androgen receptor ligand-binding domain with drug-resistance mutations. Doamekpor, S.K., Peng, P., Xu, R. et al. Acta Crystallogr F Struct Biol Commun (2023) 79:95-104. DOI 10.1107/S2053230X23002224 · PubMed

Other PDB entries of the same protein (UniProt P10275 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8E1A 1.2 Å, Structure-based study to overcome cross-reactivity of novel androgen receptor inhibitors
7ZTZ 1.4 Å, Crystal structure of mutant AR-LBD (Y764C) bound to dihydrotestosterone
4OHA 1.42 Å, Crystal structure of T877A-AR-LBD bound with co-regulator peptide
5V8Q 1.44 Å, Synthesis and biological evaluation of novel selective androgen receptor modulators…
2AX6 1.5 Å, Crystal Structure Of The Androgen Receptor Ligand Binding Domain T877A Mutant In Complex…
3L3X 1.55 Å, Crystal structure of DHT-bound androgen receptor in complex with the first motif of…
8FH0 1.59 Å, Crystal structure of mutant Androgen Receptor ligand binding domain H875Y/F877L/T878A…
8FH2 1.59 Å, Crystal structure of mutant Androgen Receptor ligand binding domain L702H/H875Y with DHT
2AM9 1.64 Å, Crystal structure of human androgen receptor ligand binding domain in complex with…
2AX9 1.65 Å, Crystal Structure Of The Androgen Receptor Ligand Binding Domain In Complex With R-3
2PNU 1.65 Å, Crystal structure of human androgen receptor ligand-binding domain in complex with EM-5744
3B66 1.65 Å, Crystal structure of the androgen receptor ligand binding domain in complex with SARM S-21

Browse structure collections

About this viewer

MolViewer shows 8FGZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.