Crystal Structure of the Tick Evasin EVA-ACA1001 Complexed to Human Chemokine CCL16. Determined by X-ray diffraction at 2.7 Å resolution. Released 17 Jan 2024.
Explore 8FK9 in 3D Show helices and sheets RCSB PDB PDBe
8FK9 contains 11 α-helices and 31 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 21-23 | 3 | |
| β-strand | 29-30 | 2 | 1 |
| β-strand | 32 | 1 | 2 |
| β-strand | 33 | 1 | 3 |
| β-strand | 41 | 1 | 2 |
| β-strand | 46-48 | 3 | 4 |
| β-strand | 53-55 | 3 | 4 |
| α-helix | 56-57 | 2 | |
| β-strand | 61-64 | 4 | 5 |
| α-helix | 67-71 | 5 | |
| β-strand | 79-87 | 9 | 5 |
| β-strand | 90-100 | 11 | 5 |
| β-strand | 101 | 1 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 29-30 | 2 | 6 |
| β-strand | 32 | 1 | 7 |
| β-strand | 33 | 1 | 8 |
| β-strand | 41 | 1 | 7 |
| β-strand | 43 | 1 | 9 |
| β-strand | 46-49 | 4 | 10 |
| β-strand | 52-55 | 4 | 10 |
| α-helix | 56-57 | 2 | |
| β-strand | 61-64 | 4 | 9 |
| α-helix | 67-71 | 5 | |
| β-strand | 79-87 | 9 | 9 |
| β-strand | 90-100 | 11 | 9 |
| β-strand | 101 | 1 | 8 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 16-17 | 2 | 1 |
| α-helix | 25-27 | 3 | |
| α-helix | 28-30 | 3 | |
| β-strand | 31-37 | 7 | 11 |
| β-strand | 44-49 | 6 | 11 |
| β-strand | 54-57 | 4 | 11 |
| α-helix | 62-69 | 8 | |
| β-strand | 75 | 1 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Evasin P991 | A, B | protein | 108 | Amblyomma cajennense | A0A023FFD0 (AlphaFold model) |
| C-C motif chemokine 16 | C, D | protein | 100 | Homo sapiens | O15467 (AlphaFold model) |
>8FK9_1 Evasin P991 (chains A, B) ENGEGTTQPDYDNSTDYYNYEDFKCTCPAPHLNNTNGTVMKPIGCYYTCNVTRCTAPDTY PCYNLTEHQAKNLTTSPTTLCAVGNCDHGICVPNGTKELCFKAPNLEE
>8FK9_2 C-C motif chemokine 16 (chains C, D) GPSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPN DDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
Structural basis of chemokine recognition by the class A3 tick evasin EVA-ACA1001. Devkota, S.R., Aryal, P., Wilce, M.C.J. et al. Protein Sci (2024) 33:e4999-e4999. DOI 10.1002/pro.4999 · PubMed
MolViewer shows 8FK9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.