8FKM: Ubiquitin-like-conjugating enzyme ATG3

Human Atg3 with deletions of residues 1 to 25 and 90 to 190. Determined by solution NMR. Released 13 Sept 2023.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 1,554
Mol. weight: 22.09 kDa
Released: 13 Sept 2023

Explore 8FKM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8FKM contains 11 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	36-49	14
β-strand	54-56	3	1
α-helix	69-71	3
β-strand	73-79	7	1
β-strand	199-207	9	1
β-strand	212-220	9	1
β-strand	226	1	1
α-helix	227-228	2
α-helix	229-232	4
α-helix	233-235	3
α-helix	238-241	4
β-strand	245-248	4	1
α-helix	254	1
α-helix	257	1
β-strand	258-261	4	1
α-helix	267-278	12
α-helix	286-288	3
α-helix	289-298	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Ubiquitin-like-conjugating enzyme ATG3	A	protein	189	Homo sapiens	Q9NT62 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8FKM_1 Ubiquitin-like-conjugating enzyme ATG3 (chains A)
GSKFKETGVITPEEFVAAGDHLVHHCPTWQWATGEELKVKAYLPTGKQFLVTKNVPCYKR
CKQMEEDAILQTRTYDLYITYDKYYQTPRLWLFGYDEQRQPLTVEHMYEDISQDHVKKTV
TIENHPHLPPPPMCSVHPCRHAEVMKKIIETVAEGGGELGVHMYLLIFLKFVQAVIPTIE
YDYTRHFTM

Primary citation

Multifaceted membrane interactions of human Atg3 promote LC3-phosphatidylethanolamine conjugation during autophagy. Ye, Y., Tyndall, E.R., Bui, V. et al. Nat Commun (2023) 14:5503-5503. DOI 10.1038/s41467-023-41243-4 · PubMed

Other PDB entries of the same protein (UniProt Q9NT62 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4NAW 2.19 Å, Crystal Structure of Human ATG12~ATG5-ATG16N in complex with a fragment of ATG3
8AFI 2.66 Å, GABARAP in complex with LIR motif of HsATG3
9E8P 2.7 Å, Crystal Structure of GABARAP-ATG3 conjugate

Browse structure collections

About this viewer

MolViewer shows 8FKM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.