Crystal structure of the C-terminal Fg domain of human TNR. Determined by X-ray diffraction at 1.75 Å resolution. Released 12 Jul 2023.
Explore 8FNA in 3D Show helices and sheets RCSB PDB PDBe
8FNA contains 9 α-helices and 18 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 1138-1143 | 6 | |
| β-strand | 1150-1155 | 6 | 1 |
| α-helix | 1156-1158 | 3 | |
| β-strand | 1163-1169 | 7 | 1 |
| α-helix | 1172-1174 | 3 | |
| β-strand | 1177-1183 | 7 | 1 |
| α-helix | 1194-1199 | 6 | |
| β-strand | 1201-1202 | 2 | 1 |
| β-strand | 1208-1209 | 2 | 1 |
| α-helix | 1212-1219 | 8 | |
| β-strand | 1224-1232 | 9 | 1 |
| β-strand | 1235-1246 | 12 | 1 |
| β-strand | 1255-1257 | 3 | 1 |
| β-strand | 1260-1262 | 3 | 1 |
| α-helix | 1269-1271 | 3 | |
| α-helix | 1274-1276 | 3 | |
| β-strand | 1277 | 1 | 2 |
| β-strand | 1278 | 1 | 3 |
| β-strand | 1281 | 1 | 3 |
| α-helix | 1290-1293 | 4 | |
| β-strand | 1298 | 1 | 2 |
| β-strand | 1306 | 1 | 4 |
| β-strand | 1311 | 1 | 5 |
| β-strand | 1320 | 1 | 5 |
| β-strand | 1323 | 1 | 4 |
| α-helix | 1324-1327 | 4 | |
| β-strand | 1335-1342 | 8 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Tenascin-R | A | protein | 234 | Homo sapiens | Q92752 (AlphaFold model) |
>8FNA_1 Tenascin-R (chains A) GPGSGRVFPHPQDCAQHLMNGDTLSGVYPIFLNGELSQKLQVYCDMTTDGGGWIVFQRRQ NGQTDFFRKWADYRVGFGNVEDEFWLGLDNIHRITSQGRYELRVDMRDGQEAAFASYDRF SVEDSRNLYKLRIGSYNGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWYKNCH RTNLNGKYGESRHSQGINWYHWKGHEFSIPFVEMKMRPYNHRLMAGRKRQSLQF
| ID | Name | Formula | Copies |
|---|---|---|---|
| CA | Calcium ion | Ca | 1 |
Water and common crystallization additives (GOL) are not listed.
Protein-protein interactions between tenascin-R and RPTP zeta /phosphacan are critical to maintain the architecture of perineuronal nets. Sinha, A., Kawakami, J., Cole, K.S. et al. J Biol Chem (2023) 299:104952-104952. DOI 10.1016/j.jbc.2023.104952 · PubMed
Other PDB entries of the same protein (UniProt Q92752 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8FNA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.