Crystal structure of tumor related RhoA mutant A161V in complex with GDP. Determined by X-ray diffraction at 1.4 Å resolution. Released 5 Jun 2024.
Explore 8FPW in 3D Show helices and sheets RCSB PDB PDBe
8FPW contains 13 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3 | 1 | |
| β-strand | 4-12 | 9 | 1 |
| α-helix | 18-23 | 6 | |
| α-helix | 29-31 | 3 | |
| β-strand | 42-48 | 7 | 1 |
| β-strand | 51-58 | 8 | 1 |
| α-helix | 64-66 | 3 | |
| α-helix | 70-73 | 4 | |
| β-strand | 79-85 | 7 | 1 |
| α-helix | 89-94 | 6 | |
| α-helix | 95-99 | 5 | |
| α-helix | 100-106 | 7 | |
| β-strand | 112-117 | 6 | 1 |
| α-helix | 119-121 | 3 | |
| α-helix | 125-132 | 8 | |
| α-helix | 138-140 | 3 | |
| α-helix | 141-151 | 11 | |
| β-strand | 155-158 | 4 | 1 |
| α-helix | 167-180 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Transforming protein RhoA | A | protein | 183 | Homo sapiens | P61586 (AlphaFold model) |
>8FPW_1 Transforming protein RhoA (chains A) GSMAAIRKKLVIVGDGACGKTCLLIVNSKDQFPEVYVPTVFENYVADIEVDGKQVELALW DTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNK KDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSVKTKDGVREVFEMATRAA LQA
| ID | Name | Formula | Copies |
|---|---|---|---|
| GDP | Guanosine-5'-diphosphate | C10 H15 N5 O11 P2 | 1 |
| DIO | 1,4-diethylene dioxide | C4 H8 O2 | 2 |
| MG | Magnesium ion | Mg | 1 |
Tumor-derived RHOA mutants interact with effectors in the GDP-bound state. Lin, Y., Ramelot, T.A., Senyuz, S. et al. Nat Commun (2024) 15:7176-7176. DOI 10.1038/s41467-024-51445-z · PubMed
Other PDB entries of the same protein (UniProt P61586 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8FPW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.