8FTD: Escherichia coli CedA

Structure of Escherichia coli CedA in complex with transcription initiation complex. Determined by electron microscopy at 2.76 Å resolution. Released 10 Jan 2024.

Method: Electron microscopy
Resolution: 2.76 Å
Organism: Escherichia coli
Chains: 10
Atoms: 32,529
Mol. weight: 559.83 kDa
Ligands: 1N7, ZN, MG
Released: 10 Jan 2024

Explore 8FTD in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8FTD contains 178 α-helices and 225 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain G: 6 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	12-15	4	1
β-strand	23-31	9	1
α-helix	35-49	15
β-strand	52-61	10	2
α-helix	78-86	9
β-strand	90-92	3	3
β-strand	97-105	9	2
β-strand	109-111	3	4
β-strand	115	1	2
α-helix	116-117	2
β-strand	121-123	3	3
β-strand	129-132	4	4
β-strand	139-150	12	2
β-strand	151-153	3	5
α-helix	155-158	4
α-helix	165-167	3
β-strand	170-172	3	2
β-strand	175-177	3	5
β-strand	180-189	10	1
β-strand	199-207	9	1
α-helix	213-229	17

Chain H: 4 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	14	1	6
β-strand	23-27	5	7
β-strand	28	1	6
β-strand	31	1	7
α-helix	35-49	15
β-strand	52-61	10	8
α-helix	78-86	9
β-strand	90-92	3	9
β-strand	97-105	9	8
β-strand	109-111	3	10
β-strand	115	1	8
α-helix	116-117	2
β-strand	121-123	3	9
β-strand	129-132	4	10
β-strand	139-150	12	8
β-strand	152-153	2	11
β-strand	172	1	8
β-strand	175-176	2	11
β-strand	180-189	10	7
β-strand	192	1	12
β-strand	195	1	12
β-strand	199-207	9	7
α-helix	215-228	14

Chain I: 61 helices, 96 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
α-helix	11-12	2
β-strand	13-14	2	13
α-helix	19-20	2
α-helix	29-38	10
α-helix	49-56	8
β-strand	59-60	2	14
β-strand	66-75	10	14
α-helix	76-78	3
α-helix	82-88	7
β-strand	93-104	12	14
α-helix	112-114	3
β-strand	116-128	13	14
β-strand	136-137	2	15
β-strand	142-145	4	15
α-helix	146	1
β-strand	147-151	5	16
α-helix	152	1
β-strand	154-158	5	17
β-strand	173-177	5	17
β-strand	180	1	18
β-strand	184-187	4	17
β-strand	195-198	4	17
β-strand	204-205	2	17
α-helix	207-212	6
α-helix	217-224	8
β-strand	227-230	4	19
β-strand	240	1	20
α-helix	243-245	3
β-strand	255-257	3	21
β-strand	260-263	4	21
α-helix	271-280	10
β-strand	284	1	20
β-strand	286	1	21
α-helix	289-291	3
β-strand	296	1	22
β-strand	297	1	19
β-strand	301-302	2	23
β-strand	309-311	3	23
β-strand	316	1	22
α-helix	319-326	8
β-strand	333-336	4	19
α-helix	346-353	8
α-helix	359-370	12
α-helix	378-389	12
β-strand	396	1	18
α-helix	399-408	10
α-helix	422-437	16
α-helix	448-450	3
β-strand	451-454	4	16
α-helix	456-480	25
α-helix	496-507	12
β-strand	512-514	3	15
α-helix	520-526	7
β-strand	529	1	24
β-strand	530-531	2	16
α-helix	552-554	3
β-strand	558	1	25
β-strand	574	1	24
β-strand	575	1	25
β-strand	580-581	2	26
β-strand	587-594	8	26
β-strand	599-607	9	26
α-helix	608-613	6
β-strand	616-617	2	26
β-strand	623	1	27
β-strand	629	1	27
β-strand	633-637	5	26
β-strand	642-646	5	26
α-helix	647-649	3
β-strand	652-654	3	26
α-helix	665-667	3
α-helix	671-673	3
β-strand	674	1	28
α-helix	676-686	11
β-strand	689	1	29
α-helix	690-692	3
β-strand	700-701	2	13
α-helix	705-711	7
β-strand	716-717	2	30
β-strand	722-727	6	31
β-strand	731-736	6	31
α-helix	737	1
α-helix	738-740	3
β-strand	748-752	5	31
α-helix	753-754	2
β-strand	757-758	2	32
β-strand	764-765	2	32
β-strand	768-769	2	30
β-strand	776-777	2	31
β-strand	782-785	4	30
β-strand	789-790	2	33
β-strand	793-794	2	33
β-strand	798-804	7	34
β-strand	816-819	4	34
α-helix	820-824	5
β-strand	830-841	12	35
β-strand	842-843	2	36
β-strand	846-847	2	36
β-strand	849	1	37
α-helix	859-861	3
β-strand	865	1	38
β-strand	870	1	39
β-strand	871	1	38
α-helix	872	1
β-strand	876-877	2	35
β-strand	882-884	3	39
β-strand	887-889	3	37
α-helix	899-906	8
β-strand	913-915	3	37
β-strand	918-919	2	39
α-helix	920-921	2
β-strand	926-935	10	35
β-strand	936	1	40
α-helix	943-981	39
α-helix	994-997	4
α-helix	1009-1037	29
β-strand	1040	1	40
β-strand	1046-1058	13	35
β-strand	1065-1067	3	41
β-strand	1073-1075	3	41
β-strand	1076-1080	5	34
α-helix	1082-1084	3
β-strand	1087	1	42
α-helix	1092	1
β-strand	1093	1	42
α-helix	1094	1
β-strand	1096-1098	3	34
α-helix	1100-1102	3
α-helix	1103-1106	4
β-strand	1108	1	28
α-helix	1110-1134	25
α-helix	1139-1150	12
α-helix	1166-1175	10
β-strand	1182-1183	2	13
α-helix	1192-1201	10
β-strand	1209-1210	2	43
β-strand	1213	1	42
α-helix	1219	1
β-strand	1220	1	42
α-helix	1221	1
β-strand	1225-1226	2	43
β-strand	1227-1232	6	34
β-strand	1233-1234	2	41
β-strand	1235	1	29
α-helix	1239-1241	3
β-strand	1244-1246	3	44
β-strand	1251	1	45
β-strand	1252	1	46
β-strand	1258	1	45
β-strand	1269-1270	2	47
α-helix	1272-1280	9
α-helix	1284-1288	5
α-helix	1289-1293	5
α-helix	1298-1310	13
α-helix	1321-1332	12
β-strand	1335-1340	6	48

Chain J: 72 helices, 83 β-strands

Element	Residues	Length	Sheet
β-strand	19-24	6	48
α-helix	25-26	2
α-helix	27-33	7
β-strand	34-37	4	49
β-strand	44	1	50
α-helix	50	1
β-strand	51	1	50
α-helix	52	1
α-helix	59-62	4
α-helix	78-80	3
α-helix	83	1
β-strand	84	1	51
α-helix	85	1
β-strand	91	1	51
α-helix	95-99	5
β-strand	102-112	11	49
α-helix	114-118	5
α-helix	123-128	6
α-helix	132-139	8
β-strand	144-147	4	52
β-strand	159-160	2	52
α-helix	162-171	10
β-strand	177-179	3	52
α-helix	182-191	10
α-helix	194-207	14
α-helix	211-229	19
α-helix	234-237	4
β-strand	238-244	7	49
α-helix	247-249	3
α-helix	253	1
β-strand	254-255	2	53
β-strand	259-260	2	53
β-strand	261-262	2	54
α-helix	264-284	21
α-helix	289-307	19
α-helix	315-316	2
β-strand	317	1	55
β-strand	323	1	55
α-helix	324	1
α-helix	327-331	5
α-helix	337-343	7
β-strand	345-346	2	47
β-strand	350-356	7	44
β-strand	365-369	5	44
α-helix	370-376	7
α-helix	378-388	11
α-helix	394-403	10
α-helix	408-415	8
β-strand	421-424	4	44
α-helix	431-433	3
β-strand	434-442	9	44
β-strand	446-448	3	44
α-helix	451-453	3
α-helix	454-457	4
β-strand	465-469	5	44
α-helix	474-482	9
β-strand	485	1	44
α-helix	486-488	3
β-strand	491	1	56
β-strand	498	1	56
α-helix	505-513	9
β-strand	526-527	2	57
α-helix	530-538	9
β-strand	547-556	10	57
β-strand	564-573	10	57
α-helix	574-579	6
α-helix	580-582	3
α-helix	589-592	4
α-helix	598-612	15
α-helix	615-635	21
α-helix	645-647	3
α-helix	650-669	20
α-helix	675-702	28
β-strand	706-707	2	58
β-strand	714-715	2	58
α-helix	721-727	7
α-helix	734-740	7
β-strand	745	1	59
β-strand	748	1	60
β-strand	754	1	60
β-strand	759	1	59
α-helix	769-801	33
β-strand	809-811	3	61
β-strand	820-821	2	62
β-strand	825	1	63
β-strand	833	1	63
α-helix	835-839	5
β-strand	843	1	64
β-strand	844	1	62
β-strand	849	1	65
β-strand	856	1	65
β-strand	863	1	64
α-helix	866-875	10
β-strand	881-882	2	62
α-helix	885-887	3
β-strand	894-895	2	61
α-helix	896-899	4
α-helix	908-910	3
α-helix	915-924	10
α-helix	925-929	5
β-strand	949-951	3	66
β-strand	957-961	5	67
β-strand	965-967	3	68
β-strand	973-975	3	68
β-strand	981-985	5	67
β-strand	991-996	6	67
α-helix	997-998	2
β-strand	1002-1003	2	66
β-strand	1010	1	67
β-strand	1016-1019	4	66
β-strand	1024-1026	3	69
β-strand	1033	1	70
β-strand	1034-1035	2	71
β-strand	1038	1	72
β-strand	1042	1	69
β-strand	1046-1050	5	69
β-strand	1057-1061	5	69
α-helix	1062	1
α-helix	1070-1073	4
β-strand	1077-1079	3	72
β-strand	1080-1081	2	71
β-strand	1087	1	71
α-helix	1088	1
β-strand	1089	1	73
α-helix	1090	1
β-strand	1096	1	73
β-strand	1098-1100	3	72
β-strand	1106-1107	2	69
β-strand	1115	1	70
β-strand	1122-1125	4	69
α-helix	1139-1146	8
α-helix	1148-1150	3
α-helix	1153-1155	3
β-strand	1156	1	74
β-strand	1161	1	75
β-strand	1162-1165	4	76
α-helix	1166-1168	3
β-strand	1173-1174	2	77
β-strand	1175-1178	4	76
β-strand	1189-1190	2	77
β-strand	1204	1	75
β-strand	1209	1	74
α-helix	1214-1216	3
α-helix	1217-1244	28
α-helix	1250-1260	11
β-strand	1263-1268	6	78
β-strand	1279-1281	3	78
α-helix	1282-1294	13
β-strand	1301-1304	4	78
α-helix	1309-1314	6
α-helix	1319-1325	7
α-helix	1328-1338	11
β-strand	1341-1343	3	48
α-helix	1348-1353	6
α-helix	1362-1372	11

Chain K: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	7-12	6
α-helix	18-31	14
α-helix	46-56	11
α-helix	61-76	16
α-helix	77-79	3

Chain L: 22 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	97-106	10
β-strand	111	1	79
α-helix	113-135	23
α-helix	138-152	15
β-strand	162	1	80
α-helix	215-232	18
α-helix	245-257	13
β-strand	261	1	80
α-helix	263-291	29
α-helix	299-306	8
α-helix	331-351	21
α-helix	356-391	36
α-helix	392-394	3
α-helix	401-416	16
α-helix	427-445	19
α-helix	454-474	21
α-helix	480-486	7
α-helix	493-499	7
α-helix	504	1
β-strand	505-506	2	54
β-strand	510	1	81
β-strand	518	1	81
α-helix	519-522	4
β-strand	524	1	46
α-helix	531-550	20
α-helix	553-562	10
α-helix	573-580	8
α-helix	584-599	16
α-helix	605-609	5

Chain R: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
β-strand	256	1	82
α-helix	257-260	4
α-helix	264-273	10
β-strand	277	1	82
α-helix	278-281	4
α-helix	286-291	6
α-helix	297-309	13

Chain Z: 3 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	6	1	79
α-helix	8-11	4
α-helix	22-24	3
β-strand	46-49	4	83
β-strand	52-55	4	83
α-helix	62-75	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
DNA-directed RNA polymerase subunit alpha	G, H, R	protein	329	Escherichia coli	P0A7Z4 (AlphaFold model)
DNA-directed RNA polymerase subunit beta	I	protein	1342	Escherichia coli	P0A8V2 (AlphaFold model)
DNA-directed RNA polymerase subunit beta'	J	protein	1407	Escherichia coli	P0A8T7 (AlphaFold model)
DNA-directed RNA polymerase subunit omega	K	protein	91	Escherichia coli	P0A800 (AlphaFold model)
RNA polymerase sigma factor RpoD	L	protein	608	Escherichia coli	P00579
Transcription Unit ssrA Promoter Non-template DNA	P	DNA	85	Escherichia coli
Transcription Unit ssrA Promoter Template DNA	Q	DNA	85	Escherichia coli
Cell division activator CedA	Z	protein	80	Escherichia coli	P0AE60

Sequence of entity 1 (G, H, R), FASTA

>8FTD_1 DNA-directed RNA polymerase subunit alpha (chains G, H, R)
MQGSVTEFLKPRLVDIEQVSSTHAKVTLEPLERGFGHTLGNALRRILLSSMPGCAVTEVE
IDGVLHEYSTKEGVQEDILEILLNLKGLAVRVQGKDEVILTLNKSGIGPVTAADITHDGD
VEIVKPQHVICHLTDENASISMRIKVQRGRGYVPASTRIHSEEDERPIGRLLVDACYSPV
ERIAYNVEAARVEQRTDLDKLVIEMETNGTIDPEEAIRRAATILAEQLEAFVDLRDVRQP
EVKEEKPEFDPILLRPVDDLELTVRSANCLKAEAIHYIGDLVQRTEVELLKTPNLGKKSL
TEIKDVLASRGLSLGMRLENWPPASIADE

Sequence of entity 2 (I), FASTA

>8FTD_2 DNA-directed RNA polymerase subunit beta (chains I)
MVYSYTEKKRIRKDFGKRPQVLDVPYLLSIQLDSFQKFIEQDPEGQYGLEAAFRSVFPIQ
SYSGNSELQYVSYRLGEPVFDVQECQIRGVTYSAPLRVKLRLVIYEREAPEGTVKDIKEQ
EVYMGEIPLMTDNGTFVINGTERVIVSQLHRSPGVFFDSDKGKTHSSGKVLYNARIIPYR
GSWLDFEFDPKDNLFVRIDRRRKLPATIILRALNYTTEQILDLFFEKVIFEIRDNKLQME
LVPERLRGETASFDIEANGKVYVEKGRRITARHIRQLEKDDVKLIEVPVEYIAGKVVAKD
YIDESTGELICAANMELSLDLLAKLSQSGHKRIETLFTNDLDHGPYISETLRVDPTNDRL
SALVEIYRMMRPGEPPTREAAESLFENLFFSEDRYDLSAVGRMKFNRSLLREEIEGSGIL
SKDDIIDVMKKLIDIRNGKGEVDDIDHLGNRRIRSVGEMAENQFRVGLVRVERAVKERLS
LGDLDTLMPQDMINAKPISAAVKEFFGSSQLSQFMDQNNPLSEITHKRRISALGPGGLTR
ERAGFEVRDVHPTHYGRVCPIETPEGPNIGLINSLSVYAQTNEYGFLETPYRKVTDGVVT
DEIHYLSAIEEGNYVIAQANSNLDEEGHFVEDLVTCRSKGESSLFSRDQVDYMDVSTQQV
VSVGASLIPFLEHDDANRALMGANMQRQAVPTLRADKPLVGTGMERAVAVDSGVTAVAKR
GGVVQYVDASRIVIKVNEDEMYPGEAGIDIYNLTKYTRSNQNTCINQMPCVSLGEPVERG
DVLADGPSTDLGELALGQNMRVAFMPWNGYNFEDSILVSERVVQEDRFTTIHIQELACVS
RDTKLGPEEITADIPNVGEAALSKLDESGIVYIGAEVTGGDILVGKVTPKGETQLTPEEK
LLRAIFGEKASDVKDSSLRVPNGVSGTVIDVQVFTRDGVEKDKRALEIEEMQLKQAKKDL
SEELQILEAGLFSRIRAVLVAGGVEAEKLDKLPRDRWLELGLTDEEKQNQLEQLAEQYDE
LKHEFEKKLEAKRRKITQGDDLAPGVLKIVKVYLAVKRRIQPGDKMAGRHGNKGVISKIN
PIEDMPYDENGTPVDIVLNPLGVPSRMNIGQILETHLGMAAKGIGDKINAMLKQQQEVAK
LREFIQRAYDLGADVRQKVDLSTFSDEEVMRLAENLRKGMPIATPVFDGAKEAEIKELLK
LGDLPTSGQIRLYDGRTGEQFERPVTVGYMYMLKLNHLVDDKMHARSTGSYSLVTQQPLG
GKAQFGGQRFGEMEVWALEAYGAAYTLQEMLTVKSDDVNGRTKMYKNIVDGNHQMEPGMP
ESFNVLLKEIRSLGINIELEDE

Sequence of entity 3 (J), FASTA

>8FTD_3 DNA-directed RNA polymerase subunit beta' (chains J)
MKDLLKFLKAQTKTEEFDAIKIALASPDMIRSWSFGEVKKPETINYRTFKPERDGLFCAR
IFGPVKDYECLCGKYKRLKHRGVICEKCGVEVTQTKVRRERMGHIELASPTAHIWFLKSL
PSRIGLLLDMPLRDIERVLYFESYVVIEGGMTNLERQQILTEEQYLDALEEFGDEFDAKM
GAEAIQALLKSMDLEQECEQLREELNETNSETKRKKLTKRIKLLEAFVQSGNKPEWMILT
VLPVLPPDLRPLVPLDGGRFATSDLNDLYRRVINRNNRLKRLLDLAAPDIIVRNEKRMLQ
EAVDALLDNGRRGRAITGSNKRPLKSLADMIKGKQGRFRQNLLGKRVDYSGRSVITVGPY
LRLHQCGLPKKMALELFKPFIYGKLELRGLATTIKAAKKMVEREEAVVWDILDEVIREHP
VLLNRAPTLHRLGIQAFEPVLIEGKAIQLHPLVCAAYNADFDGDQMAVHVPLTLEAQLEA
RALMMSTNNILSPANGEPIIVPSQDVVLGLYYMTRDCVNAKGEGMVLTGPKEAERLYRSG
LASLHARVKVRITEYEKDANGELVAKTSLKDTTVGRAILWMIVPKGLPYSIVNQALGKKA
ISKMLNTCYRILGLKPTVIFADQIMYTGFAYAARSGASVGIDDMVIPEKKHEIISEAEAE
VAEIQEQFQSGLVTAGERYNKVIDIWAAANDRVSKAMMDNLQTETVINRDGQEEKQVSFN
SIYMMADSGARGSAAQIRQLAGMRGLMAKPDGSIIETPITANFREGLNVLQYFISTHGAR
KGLADTALKTANSGYLTRRLVDVAQDLVVTEDDCGTHEGIMMTPVIEGGDVKEPLRDRVL
GRVTAEDVLKPGTADILVPRNTLLHEQWCDLLEENSVDAVKVRSVVSCDTDFGVCAHCYG
RDLARGHIINKGEAIGVIAAQSIGEPGTQLTMRTFHIGGAASRAAAESSIQVKNKGSIKL
SNVKSVVNSSGKLVITSRNTELKLIDEFGRTKESYKVPYGAVLAKGDGEQVAGGETVANW
DPHTMPVITEVSGFVRFTDMIDGQTITRQTDELTGLSSLVVLDSAERTAGGKDLRPALKI
VDAQGNDVLIPGTDMPAQYFLPGKAIVQLEDGVQISSGDTLARIPQESGGTKDITGGLPR
VADLFEARRPKEPAILAEISGIVSFGKETKGKRRLVITPVDGSDPYEEMIPKWRQLNVFE
GERVERGDVISDGPEAPHDILRLRGVHAVTRYIVNEVQDVYRLQGVKINDKHIEVIVRQM
LRKATIVNAGSSDFLEGEQVEYSRVKIANRELEANGKVGATYSRDLLGITKASLATESFI
SAASFQETTRVLTEAAVAGKRDELRGLKENVIVGRLIPAGTGYAYHQDRMRRRAAGEAPA
APQVTAEDASASLAELLNAGLGGSDNE

Sequence of entity 4 (K), FASTA

>8FTD_4 DNA-directed RNA polymerase subunit omega (chains K)
MARVTVQDAVEKIGNRFDLVLVAARRARQMQVGGKDPLVPEENDKTTVIALREIEEGLIN
NQILDVRERQEQQEQEAAELQAVTAIAEGRR

Sequence of entity 5 (L), FASTA

>8FTD_5 RNA polymerase sigma factor RpoD (chains L)
MEQNPQSQLKLLVTRGKEQGYLTYAEVNDHLPEDIVDSDQIEDIIQMINDMGIQVMEEAP
DADDLMLAENTADEDAAEAAAQVLSSVESEIGRTTDPVRMYMREMGTVELLTREGEIDIA
KRIEDGINQVQCSVAEYPEAITYLLEQYDRVEAEEARLSDLITGFVDPNAEEDLAPTATH
VGSELSQEDLDDDEDEDEEDGDDDSADDDNSIDPELAREKFAELRAQYVVTRDTIKHATA
QEEILKLSEVFKQFRLVPKQFDYLVNSMRVMMDRVRTQERLIMKLCVEQCKMPKKNFITL
FTGNETSDTWFNAAIAMNKPWSEKLHDVSEEVHRALQKLQQIEEETGLTIEQVKDINRRM
SIGEAKARRAKKEMVEANLRLVISIAKKYTNRGLQFLDLIQEGNIGLMKAVDKFEYRRGY
KFSTYATWWIRQAITRSIADQARTIRIPVHMIETINKLNRISRQMLQEMGREPTPEELAE
RMLMPEDKIRKVLKIAKEPISMETPIGDDEDSHLGDFIEDTTLELPLDSATTESLRAATH
DVLAGLTAREAKVLRMRFGIDMNTDYTLEEVGKQFDVTRERIRQIEAKALRKLRHPSRSE
VLRSFLDD

Sequence of entity 6 (P), FASTA

>8FTD_6 Transcription Unit ssrA Promoter Non-template DNA (chains P)
TTTAACGATAACGCCATTGAGGCTGGTCATGGCGCTCATAAATCTGGTATACTTACCTTT
ACACATTGGGGCTGATTCTGGATTC

Sequence of entity 7 (Q), FASTA

>8FTD_7 Transcription Unit ssrA Promoter Template DNA (chains Q)
GAATCCAGAATCAGCCCCAATGTGTAAAGGTAAGTATACCAGATTTATGAGCGCCATGAC
CAGCCTCAATGGCGTTATCGTTAAA

Sequence of entity 8 (Z), FASTA

>8FTD_8 Cell division activator CedA (chains Z)
MKKPLRQQNRQIISYVPRTEPAPPEHAIKMDSFRDVWMLRGKYVAFVLMGESFLRSPAFT
VPESAQRWANQIRQEGEVTE

Ligands and cofactors

ID	Name	Formula	Copies
1N7	Chapso	C32 H59 N2 O8 S	3
ZN	Zinc ion	Zn	2
MG	Magnesium ion	Mg	1

Primary citation

General transcription factor from Escherichia coli with a distinct mechanism of action. Vasilyev, N., Liu, M.M.J., Epshtein, V. et al. Nat Struct Mol Biol (2024) 31:141-149. DOI 10.1038/s41594-023-01154-w · PubMed

Other PDB entries of the same protein (UniProt P0A7Z4 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3K4G 2.05 Å, Crystal structure of E. coli RNA polymerase alpha subunit C-terminal domain
8FVW 2.1 Å, CryoEM structure of E.coli transcription elongation complex bound to ppGpp
8FVR 2.42 Å, CryoEM structure of E.coli transcription elongation complex
9ZP4 2.42 Å, E. coli RNA polymerase elongation complex containing the unnatural dZ:PTP base pair in a…
8HKC 2.49 Å, Cryo-EM structure of E. coli RNAP sigma32 complex
1BDF 2.5 Å, Structure of escherichia coli RNA polymerase alpha subunit N-terminal domain
6XL5 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter open complex (EcmrR-RPo)
6XL9 2.5 Å, Cryo-EM structure of EcmrR-RNAP-promoter initial transcribing complex with 3-nt RNA…
12EC 2.6 Å, Half-translocated RNA polymerase elemental paused elongation complex, swiveled (ePEC…
8F1J 2.6 Å, SigN RNA polymerase early-melted intermediate bound to mismatch DNA fragment dhsU36mm2…
8PIB 2.6 Å, autoinhibited RfaH bound to E. coli transcription complex paused at ops site (encounter…
9MSF 2.6 Å, de novo SigN RNA polymerase transcription initiation intermediate with post-catalytic…

Browse structure collections

About this viewer

MolViewer shows 8FTD directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.