8G0M: Complex between TV6.6 and CD98hc ECD

Structure of complex between TV6.6 and CD98hc ECD. Determined by X-ray diffraction at 2.25 Å resolution. Released 18 Oct 2023.

Method: X-ray diffraction
Resolution: 2.25 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 5,180
Mol. weight: 74.64 kDa
Released: 18 Oct 2023

Explore 8G0M in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8G0M contains 36 α-helices and 39 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 19 β-strands

Element	Residues	Length	Sheet
α-helix	218-220	3
β-strand	224-227	4	1
α-helix	230-234	5
α-helix	241-245	5
α-helix	248-254	7
β-strand	258-261	4	1
β-strand	265-266	2	2
β-strand	276-280	5	2
α-helix	287-299	13
β-strand	303-307	5	1
α-helix	323-340	18
β-strand	344-347	4	1
α-helix	350-352	3
α-helix	356-370	15
β-strand	375-379	5	1
α-helix	385-392	8
β-strand	399-401	3	1
α-helix	412-425	14
β-strand	432-433	2	3
α-helix	441-443	3
α-helix	447-449	3
α-helix	450-457	8
β-strand	463-464	2	3
β-strand	465-467	3	1
α-helix	470-472	3
α-helix	476-478	3
α-helix	487-489	3
α-helix	505-507	3
α-helix	509-513	5
α-helix	519-532	14
α-helix	534-538	5
β-strand	540-544	5	4
β-strand	550-556	7	4
α-helix	561	1
β-strand	562-568	7	4
β-strand	574-575	2	5
α-helix	585-587	3
α-helix	588-590	3
β-strand	592-598	7	4
β-strand	608-610	3	4
α-helix	611-613	3
β-strand	615-616	2	5
α-helix	617	1
β-strand	621-626	6	4

Chain B: 11 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	239-243	5	6
α-helix	244-246	3
α-helix	247-251	5
β-strand	258-266	9	6
β-strand	274-279	6	7
β-strand	282-284	3	7
β-strand	288-289	2	6
α-helix	290-292	3
β-strand	293-294	2	6
β-strand	300-307	8	6
α-helix	310-314	5
β-strand	319-324	6	7
β-strand	332-336	5	7
α-helix	338-340	3
β-strand	344	1	8
α-helix	345-346	2
β-strand	347-351	5	9
α-helix	352-354	3
α-helix	355-359	5
β-strand	362-372	11	9
β-strand	373	1	8
β-strand	378-383	6	10
β-strand	387-388	2	10
β-strand	391-393	3	9
α-helix	394-396	3
β-strand	397-398	2	9
β-strand	404-413	10	9
α-helix	414-418	5
β-strand	423-428	6	10
α-helix	433-435	3
β-strand	436-441	6	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
4F2 cell-surface antigen heavy chain	A	protein	425	Homo sapiens	P08195 (AlphaFold model)
TV 6.6 Fc fragment	B	protein	227	synthetic construct

Sequence of entity 1 (A), FASTA

>8G0M_1 4F2 cell-surface antigen heavy chain (chains A)
ELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPIHKNQKDD
VAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVDTVATKVK
DALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSDLQQILSL
LESNKDLLLTSSYLSDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSFLPAQLLR
LYQLMLFTLPGTPVFSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVSANMTVKG
QSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFLVVLNFGD
VGLSAGLQASDLPASASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLLRFPYAAE
NLYFQ

Sequence of entity 2 (B), FASTA

>8G0M_2 TV 6.6 Fc fragment (chains B)
DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVD
GVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAK
GQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVLWNSRFVLENNYKTTPPVLDS
DGSFFLYSKLTVDKSRWQQGNIFACNVYHEALHNHYTFKNLALSPGK

Primary citation

CD98hc is a target for brain delivery of biotherapeutics. Chew, K.S., Wells, R.C., Moshkforoush, A. et al. Nat Commun (2023) 14:5053-5053. DOI 10.1038/s41467-023-40681-4 · PubMed

Other PDB entries of the same protein (UniProt P08195 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S8V 1.8 Å, Structure of the high affinity Anticalin P3D11 in complex with the human CD98 heavy…
2DH2 2.1 Å, Crystal Structure of human ED-4F2hc
9KJU 2.7 Å, Local refinement of the y+LAT1-4F2hc bound with Arg
2DH3 2.8 Å, Crystal Structure of human ED-4F2hc
7DF1 2.81 Å, Crystal structure of human CD98 heavy chain extracellular domain in complex with S1-F4…
7CMI 2.9 Å, The LAT2-4F2hc complex in complex with leucine
7DSK 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-075
7DSL 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-078
8YLP 2.9 Å, Overall structure of the y+LAT1-4F2hc bound with Arg
7DSN 3.1 Å, Overall structure of the LAT1-4F2hc bound with JX-119
8X0W 3.1 Å, Overall structure of the LAT1-4F2hc bound with Leu
8A6L 3.18 Å, Human 4F2hc-LAT2 heterodimeric amino acid transporter in complex with anticalin D11vs

Browse structure collections

About this viewer

MolViewer shows 8G0M directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.