8G0P: Human Ndc80:Nuf2 loop region

Crystal structure of the human Ndc80:Nuf2 loop region. Determined by X-ray diffraction at 2.0 Å resolution. Released 29 Mar 2023.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 1,989
Mol. weight: 28.22 kDa
Released: 29 Mar 2023

Explore 8G0P in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8G0P contains 5 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	4-54	51
α-helix	84-86	3
α-helix	87-91	5
α-helix	92-142	51

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-96	95

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Kinetochore protein NDC80 homolog	A	protein	143	Homo sapiens	O14777 (AlphaFold model)
Kinetochore protein Nuf2	B	protein	98	Homo sapiens	Q9BZD4 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8G0P_1 Kinetochore protein NDC80 homolog (chains A)
SCNHERNELQQTINKLTKDLEAEQQKLWNEELKYARGKEAIETQLAEYHKLARKLKLIPK
GAENSKGYDFEIKFNPEAGANCLVKYRAQVYVPLKELLNETEEEINKALNKKMGLEDTLE
QLNAMITESKRSVRTLKEEVQKC

Sequence of entity 2 (B), FASTA

>8G0P_2 Kinetochore protein Nuf2 (chains B)
CKNYKEKMKDTVQKLKNARQEVVEKYEIYGDSVDCLPSCQLEVQLYQKKIQDLSDNREKL
ASILKESLNLEDQIESDESELKKLKTEENSFKRLMIVC

Primary citation

Structure of the Ndc80 complex and its interactions at the yeast kinetochore-microtubule interface. Zahm, J.A., Jenni, S., Harrison, S.C. Open Biol (2023) 13:220378-220378. DOI 10.1098/rsob.220378 · PubMed

Other PDB entries of the same protein (UniProt O14777 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2IGP 1.8 Å, Crystal Structure of Hec1 CH domain
2VE7 2.88 Å, Crystal structure of a bonsai version of the human Ndc80 complex
9N9G 3.0 Å, Cryo-EM structure of the human Hec1-Nuf2 dimer bound to the paclitaxel-stabilized…
3IZ0 8.6 Å, Human Ndc80 Bonsai Decorated Microtubule

Browse structure collections

About this viewer

MolViewer shows 8G0P directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.