CryoEM structure of cytoplasmic GAPDH under 24h Oxidative Stress. Determined by electron microscopy at 2.07 Å resolution. Released 27 Dec 2023.
Explore 8G16 in 3D Show helices and sheets RCSB PDB PDBe
8G16 contains 60 α-helices and 77 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-4 | 2 | |
| β-strand | 5-9 | 5 | 1 |
| α-helix | 13-25 | 13 | |
| β-strand | 29-34 | 6 | 1 |
| α-helix | 40-48 | 9 | |
| β-strand | 60-63 | 4 | 2 |
| β-strand | 66-69 | 4 | 2 |
| β-strand | 72-74 | 3 | 2 |
| β-strand | 75-77 | 3 | 1 |
| α-helix | 82-84 | 3 | |
| β-strand | 94-97 | 4 | 1 |
| α-helix | 105-108 | 4 | |
| α-helix | 109-112 | 4 | |
| β-strand | 118-121 | 4 | 1 |
| α-helix | 129 | 1 | |
| β-strand | 130 | 1 | 1 |
| α-helix | 137-139 | 3 | |
| β-strand | 146-148 | 3 | 1 |
| α-helix | 152-168 | 17 | |
| β-strand | 170-179 | 10 | 3 |
| β-strand | 186 | 1 | 4 |
| α-helix | 197-199 | 3 | |
| β-strand | 201 | 1 | 4 |
| β-strand | 208-210 | 3 | 3 |
| α-helix | 213-220 | 8 | |
| α-helix | 222-224 | 3 | |
| β-strand | 228-234 | 7 | 3 |
| β-strand | 240-249 | 10 | 3 |
| α-helix | 255-267 | 13 | |
| β-strand | 274-277 | 4 | 3 |
| α-helix | 283-286 | 4 | |
| β-strand | 293-304 | 12 | 3 |
| β-strand | 307-315 | 9 | 3 |
| α-helix | 318-333 | 16 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 3-4 | 2 | |
| β-strand | 5-9 | 5 | 5 |
| α-helix | 13-25 | 13 | |
| β-strand | 29-34 | 6 | 5 |
| α-helix | 40-48 | 9 | |
| β-strand | 60-63 | 4 | 6 |
| β-strand | 66-69 | 4 | 6 |
| β-strand | 72-74 | 3 | 6 |
| β-strand | 75-77 | 3 | 5 |
| α-helix | 82-84 | 3 | |
| β-strand | 94-97 | 4 | 5 |
| α-helix | 105-108 | 4 | |
| α-helix | 109-112 | 4 | |
| β-strand | 118-121 | 4 | 5 |
| α-helix | 129 | 1 | |
| β-strand | 130 | 1 | 5 |
| α-helix | 137-139 | 3 | |
| β-strand | 146-148 | 3 | 5 |
| α-helix | 152-168 | 17 | |
| β-strand | 170-179 | 10 | 7 |
| β-strand | 186 | 1 | 8 |
| α-helix | 197-199 | 3 | |
| β-strand | 201 | 1 | 8 |
| β-strand | 208-210 | 3 | 7 |
| α-helix | 213-220 | 8 | |
| α-helix | 222-224 | 3 | |
| β-strand | 228-234 | 7 | 7 |
| β-strand | 240-249 | 10 | 7 |
| α-helix | 255-267 | 13 | |
| β-strand | 274-277 | 4 | 7 |
| α-helix | 283-286 | 4 | |
| β-strand | 293-296 | 4 | 7 |
| β-strand | 301-304 | 4 | 7 |
| β-strand | 307-315 | 9 | 7 |
| α-helix | 318-333 | 16 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Glyceraldehyde-3-phosphate dehydrogenase | A, B, C, D | protein | 334 | Homo sapiens | P04406 (AlphaFold model) |
>8G16_1 Glyceraldehyde-3-phosphate dehydrogenase (chains A, B, C, D) GKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTVK AENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVII SAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHAI TATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANVS VVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAGI ALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE
Efficient tagging of endogenous proteins in human cell lines for structural studies by single-particle cryo-EM. Choi, W., Wu, H., Yserentant, K. et al. Proc Natl Acad Sci U S A (2023) 120:e2302471120-e2302471120. DOI 10.1073/pnas.2302471120 · PubMed
Other PDB entries of the same protein (UniProt P04406 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8G16 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.