8GJ5: Fungal pcna and peptidomimetic

fungal pcna and peptidomimetic. Determined by X-ray diffraction at 2.3 Å resolution. Released 24 Jan 2024.

Method: X-ray diffraction
Resolution: 2.3 Å
Organisms: Aspergillus fumigatus, synthetic construct
Chains: 6
Atoms: 6,017
Mol. weight: 90.95 kDa
Released: 24 Jan 2024

Explore 8GJ5 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8GJ5 contains 29 α-helices and 64 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
α-helix	10-19	10
β-strand	25-31	7	2
β-strand	34-40	7	2
β-strand	46-53	8	2
α-helix	54-56	3
β-strand	57-62	6	1
β-strand	66-71	6	2
α-helix	72-79	8
β-strand	87-92	6	1
β-strand	98-104	7	1
β-strand	110-117	8	1
α-helix	118	1
β-strand	127	1	3
β-strand	135-140	6	2
α-helix	141-152	12
β-strand	157-162	6	4
β-strand	166-172	7	4
β-strand	176-183	8	4
β-strand	185	1	5
α-helix	191-193	3
β-strand	195	1	5
β-strand	196-199	4	2
β-strand	203-208	6	4
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-229	6	2
β-strand	235-240	6	2
β-strand	244-250	7	2

Chain B: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	6
α-helix	10-17	8
β-strand	25-31	7	7
β-strand	34-40	7	7
β-strand	46-53	8	7
α-helix	54-56	3
β-strand	60-62	3	6
β-strand	66-71	6	7
α-helix	72-79	8
β-strand	86-92	7	6
β-strand	98-105	8	6
β-strand	111-117	7	6
α-helix	118	1
β-strand	127	1	8
β-strand	135-140	6	7
α-helix	141-152	12
β-strand	157-162	6	1
β-strand	167-172	6	1
β-strand	176-182	7	1
α-helix	191-193	3
β-strand	196-199	4	7
β-strand	203-208	6	1
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-229	6	7
β-strand	235-242	8	7
β-strand	244-250	7	7
α-helix	251-253	3

Chain C: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	4
α-helix	10-17	8
β-strand	25-31	7	9
β-strand	34-40	7	9
β-strand	46-53	8	9
α-helix	54-56	3
β-strand	60-62	3	4
β-strand	66-71	6	9
α-helix	72-79	8
β-strand	87-92	6	4
β-strand	98-104	7	4
β-strand	111-117	7	4
α-helix	118	1
β-strand	126	1	10
β-strand	135-140	6	9
α-helix	141-152	12
β-strand	157-162	6	6
β-strand	166-172	7	6
β-strand	176-183	8	6
β-strand	185	1	11
α-helix	191-193	3
β-strand	195	1	11
β-strand	196-199	4	9
β-strand	203-208	6	6
α-helix	209-215	7
α-helix	216-221	6
β-strand	224-229	6	9
β-strand	235-240	6	9
β-strand	244-250	7	9
α-helix	251-253	3

Chain D: 0 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	6	1	3

Chain E: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	295-297	3
α-helix	301-303	3
β-strand	306	1	8

Chain F: 1 helix, 1 β-strand

Element	Residues	Length	Sheet
α-helix	301-303	3
β-strand	307	1	10

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Proliferating cell nuclear antigen	A, B, C	protein	257	Aspergillus fumigatus	A0A229Y5V5 (AlphaFold model)
Thr-asp-ile-arg-asn-phe-phe-his-ser	D, E, F	protein	16	synthetic construct

Sequence of entity 1 (A, B, C), FASTA

>8GJ5_1 Proliferating cell nuclear antigen (chains A, B, C)
MLEARLEQASLLKRVVDAIKDLVQDCNFDCNDSGIALQAMDNSHVALVSMLLKAEGFSPY
RCDRNIALGINLVSLTKVLRAAQNEDILTLKADDSPDAVNLMFESAETDRISEYDIKLMD
IDQEHLAIPETEYAATVEMPSAEFQRICRDLNALSESVVIEATKEGVKFSCQGDIGSGSV
TIRQHTSVDKPEQNVSIALSEPVALTFSLKYLVNFCKATSLSSKVTLCLSQEVPLLVEYG
LGSGHLRFYLAPKIGDE

Sequence of entity 2 (D, E, F), FASTA

>8GJ5_2 THR-ASP-ILE-ARG-ASN-PHE-PHE-HIS-SER (chains D, E, F)
KRRMPTDIRNFFHSKR

Primary citation

Towards a High-Affinity Peptidomimetic Targeting Proliferating Cell Nuclear Antigen from Aspergillus fumigatus. Vandborg, B.C., Horsfall, A.J., Pederick, J.L. et al. J Fungi (Basel) (2023) 9. DOI 10.3390/jof9111098 · PubMed

Other PDB entries of the same protein (UniProt A0A229Y5V5 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8GJF 2.0 Å, afupcna bound with peptide mimetic

Browse structure collections

About this viewer

MolViewer shows 8GJ5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.